Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8BG96

Protein Details
Accession G8BG96    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-29GSKKEGKVKEIKVKEPKVKESKDKPEETBasic
NLS Segment(s)
PositionSequence
5-22KEGKVKEIKVKEPKVKES
48-87KPLASKKLNKKILKTVKKASKAKHVKRGVKEVVKALRKGE
Subcellular Location(s) cyto 12, mito_nucl 8, nucl 7.5, mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002415  H/ACA_rnp_Nhp2-like  
IPR029064  L30e-like  
IPR004038  Ribosomal_L7Ae/L30e/S12e/Gad45  
IPR018492  Ribosomal_L7Ae/L8/Nhp2  
Gene Ontology GO:0031429  C:box H/ACA snoRNP complex  
GO:0034513  F:box H/ACA snoRNA binding  
GO:0000493  P:box H/ACA snoRNP assembly  
GO:0000469  P:cleavage involved in rRNA processing  
GO:0000454  P:snoRNA guided rRNA pseudouridine synthesis  
GO:0031120  P:snRNA pseudouridine synthesis  
Pfam View protein in Pfam  
PF01248  Ribosomal_L7Ae  
Amino Acid Sequences MGSKKEGKVKEIKVKEPKVKESKDKPEETISIEDNYEKRMAAILPFAKPLASKKLNKKILKTVKKASKAKHVKRGVKEVVKALRKGEKGLVIIAGDISPADVISHIPVLCEDNAVLYVFVPSKEDLGSAGATKRPTSCVMIVPGGGKSKKNADKVDEYREGYDEIVKEIKTSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.81
3 0.78
4 0.79
5 0.79
6 0.79
7 0.8
8 0.8
9 0.81
10 0.81
11 0.77
12 0.71
13 0.67
14 0.61
15 0.55
16 0.49
17 0.4
18 0.32
19 0.29
20 0.28
21 0.23
22 0.23
23 0.19
24 0.15
25 0.13
26 0.13
27 0.13
28 0.11
29 0.16
30 0.17
31 0.17
32 0.18
33 0.18
34 0.16
35 0.17
36 0.19
37 0.22
38 0.27
39 0.33
40 0.42
41 0.53
42 0.62
43 0.65
44 0.67
45 0.68
46 0.72
47 0.74
48 0.71
49 0.7
50 0.69
51 0.75
52 0.76
53 0.69
54 0.69
55 0.71
56 0.72
57 0.72
58 0.73
59 0.71
60 0.7
61 0.74
62 0.71
63 0.64
64 0.59
65 0.54
66 0.52
67 0.48
68 0.45
69 0.38
70 0.37
71 0.33
72 0.32
73 0.28
74 0.23
75 0.2
76 0.19
77 0.17
78 0.11
79 0.1
80 0.09
81 0.07
82 0.04
83 0.04
84 0.03
85 0.03
86 0.02
87 0.03
88 0.03
89 0.03
90 0.04
91 0.06
92 0.05
93 0.06
94 0.06
95 0.08
96 0.08
97 0.08
98 0.07
99 0.06
100 0.07
101 0.07
102 0.07
103 0.05
104 0.06
105 0.06
106 0.07
107 0.08
108 0.07
109 0.08
110 0.08
111 0.08
112 0.08
113 0.09
114 0.09
115 0.09
116 0.11
117 0.13
118 0.14
119 0.15
120 0.15
121 0.16
122 0.18
123 0.21
124 0.21
125 0.22
126 0.25
127 0.24
128 0.24
129 0.23
130 0.22
131 0.25
132 0.25
133 0.22
134 0.22
135 0.31
136 0.37
137 0.44
138 0.47
139 0.47
140 0.55
141 0.6
142 0.65
143 0.62
144 0.58
145 0.52
146 0.49
147 0.43
148 0.34
149 0.32
150 0.24
151 0.21
152 0.22
153 0.2