Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9SHQ5

Protein Details
Accession A0A1L9SHQ5    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
210-237SSLVDFFVKKKKRDKKLFPDPSRRGYVPHydrophilic
NLS Segment(s)
PositionSequence
218-226KKKKRDKKL
Subcellular Location(s) nucl 15, cyto 8, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
CDD cd00882  Ras_like_GTPase  
Amino Acid Sequences MESSSGLWERKYGSMTEKPDSVSWIAAMDMLKLGEAKRDPEVITIAILGVKGAGKSAFISNLVGEKLDPDTKEVSMHSYEYNEFIHVCFIDTRSFDGITKTDFDVLREVDAFLDKSHEIKIRLDGIIYFHQIGDNRMQGPVSKSMLMLWKLLKREAYRKVMLVTSMWDTVDFNQGKELEKAFVNTSTLLTTIRRNRWQIARHWGTKESASSLVDFFVKKKKRDKKLFPDPSRRGYVPDAEIKQRHL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.38
3 0.4
4 0.39
5 0.38
6 0.37
7 0.38
8 0.32
9 0.25
10 0.2
11 0.17
12 0.14
13 0.14
14 0.13
15 0.1
16 0.1
17 0.09
18 0.09
19 0.09
20 0.09
21 0.13
22 0.14
23 0.16
24 0.18
25 0.21
26 0.21
27 0.22
28 0.23
29 0.18
30 0.17
31 0.14
32 0.12
33 0.1
34 0.09
35 0.07
36 0.06
37 0.06
38 0.05
39 0.06
40 0.06
41 0.06
42 0.08
43 0.09
44 0.1
45 0.1
46 0.1
47 0.1
48 0.12
49 0.12
50 0.1
51 0.09
52 0.09
53 0.11
54 0.14
55 0.13
56 0.14
57 0.15
58 0.16
59 0.17
60 0.16
61 0.16
62 0.15
63 0.16
64 0.14
65 0.15
66 0.15
67 0.15
68 0.15
69 0.13
70 0.11
71 0.1
72 0.11
73 0.09
74 0.09
75 0.08
76 0.09
77 0.11
78 0.11
79 0.13
80 0.13
81 0.14
82 0.13
83 0.14
84 0.13
85 0.12
86 0.14
87 0.12
88 0.14
89 0.14
90 0.14
91 0.15
92 0.15
93 0.14
94 0.12
95 0.12
96 0.09
97 0.09
98 0.09
99 0.06
100 0.08
101 0.07
102 0.08
103 0.1
104 0.13
105 0.14
106 0.14
107 0.17
108 0.17
109 0.17
110 0.16
111 0.14
112 0.14
113 0.14
114 0.14
115 0.12
116 0.1
117 0.11
118 0.11
119 0.12
120 0.12
121 0.12
122 0.11
123 0.11
124 0.11
125 0.11
126 0.13
127 0.15
128 0.14
129 0.13
130 0.13
131 0.14
132 0.18
133 0.18
134 0.18
135 0.17
136 0.19
137 0.2
138 0.22
139 0.25
140 0.23
141 0.3
142 0.36
143 0.39
144 0.38
145 0.38
146 0.38
147 0.35
148 0.32
149 0.25
150 0.19
151 0.15
152 0.14
153 0.13
154 0.11
155 0.11
156 0.11
157 0.2
158 0.18
159 0.15
160 0.18
161 0.19
162 0.21
163 0.22
164 0.22
165 0.15
166 0.16
167 0.17
168 0.16
169 0.16
170 0.15
171 0.14
172 0.13
173 0.12
174 0.12
175 0.12
176 0.12
177 0.18
178 0.25
179 0.32
180 0.38
181 0.42
182 0.48
183 0.55
184 0.59
185 0.59
186 0.62
187 0.62
188 0.61
189 0.62
190 0.58
191 0.52
192 0.49
193 0.43
194 0.35
195 0.3
196 0.25
197 0.23
198 0.2
199 0.19
200 0.19
201 0.17
202 0.17
203 0.24
204 0.3
205 0.36
206 0.46
207 0.55
208 0.64
209 0.75
210 0.83
211 0.85
212 0.89
213 0.93
214 0.93
215 0.94
216 0.9
217 0.87
218 0.83
219 0.73
220 0.66
221 0.59
222 0.55
223 0.5
224 0.52
225 0.49
226 0.5