Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9SLF6

Protein Details
Accession A0A1L9SLF6   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
70-89INSNKKKAAKANKAAGKKKNHydrophilic
NLS Segment(s)
PositionSequence
74-89KKKAAKANKAAGKKKN
Subcellular Location(s) plas 13, mito 6, E.R. 3, golg 3, cyto_mito 3, mito_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009914  DPM2  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0030234  F:enzyme regulator activity  
GO:0019348  P:dolichol metabolic process  
GO:0006486  P:protein glycosylation  
Pfam View protein in Pfam  
PF07297  DPM2  
Amino Acid Sequences LGPLVGSAMLLVATAIFLYYTAWTLLMPFVDPGHPLHDLFPPRVWAIRIPVILTLLGSAVVGTFIGIVMINSNKKKAAKANKAAGKKKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.03
5 0.04
6 0.04
7 0.05
8 0.05
9 0.06
10 0.06
11 0.06
12 0.07
13 0.06
14 0.06
15 0.06
16 0.06
17 0.07
18 0.08
19 0.08
20 0.1
21 0.11
22 0.11
23 0.12
24 0.16
25 0.17
26 0.18
27 0.17
28 0.17
29 0.16
30 0.17
31 0.16
32 0.13
33 0.14
34 0.16
35 0.16
36 0.14
37 0.14
38 0.14
39 0.13
40 0.12
41 0.08
42 0.05
43 0.05
44 0.04
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.02
51 0.02
52 0.03
53 0.03
54 0.03
55 0.05
56 0.08
57 0.13
58 0.15
59 0.17
60 0.21
61 0.23
62 0.28
63 0.36
64 0.44
65 0.49
66 0.58
67 0.66
68 0.71
69 0.79