Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9SR19

Protein Details
Accession A0A1L9SR19   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
51-72LRAVPKKKTSHMKKRHRQMAGKBasic
NLS Segment(s)
PositionSequence
55-71PKKKTSHMKKRHRQMAG
Subcellular Location(s) mito 23.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MAARLFSPAASIARWAQFVQNPSVLSQTLFQPATLTLTIPGLLSDIWDSILRAVPKKKTSHMKKRHRQMAGKALKDVKNLNTCPGCGQIKRAHVLCPHCVSDIKKQWATAKTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.2
4 0.23
5 0.25
6 0.26
7 0.26
8 0.24
9 0.24
10 0.25
11 0.21
12 0.18
13 0.16
14 0.15
15 0.17
16 0.16
17 0.15
18 0.14
19 0.14
20 0.16
21 0.15
22 0.13
23 0.09
24 0.09
25 0.09
26 0.08
27 0.08
28 0.05
29 0.05
30 0.05
31 0.05
32 0.05
33 0.05
34 0.06
35 0.06
36 0.06
37 0.09
38 0.09
39 0.12
40 0.16
41 0.2
42 0.25
43 0.27
44 0.32
45 0.4
46 0.5
47 0.58
48 0.65
49 0.72
50 0.76
51 0.84
52 0.87
53 0.84
54 0.8
55 0.76
56 0.76
57 0.73
58 0.65
59 0.59
60 0.57
61 0.52
62 0.48
63 0.43
64 0.39
65 0.38
66 0.37
67 0.39
68 0.34
69 0.32
70 0.32
71 0.35
72 0.33
73 0.26
74 0.31
75 0.3
76 0.34
77 0.39
78 0.38
79 0.37
80 0.39
81 0.43
82 0.44
83 0.42
84 0.4
85 0.37
86 0.4
87 0.39
88 0.44
89 0.49
90 0.51
91 0.48
92 0.5
93 0.55