Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9STE3

Protein Details
Accession A0A1L9STE3   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
71-105GTKSMSPSHHPRRRERGGRKGKKGKRENKKKIKKKBasic
NLS Segment(s)
PositionSequence
78-105SHHPRRRERGGRKGKKGKRENKKKIKKK
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, cyto 1.5
Family & Domain DBs
Amino Acid Sequences MPANASNCDGFFPPGTSPVHCQASLSVLVQTRHLLRLDRSQKSIVEHNSDNSSSGGSGRCSNGGGNGRNAGTKSMSPSHHPRRRERGGRKGKKGKRENKKKIKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.2
4 0.24
5 0.28
6 0.3
7 0.28
8 0.27
9 0.24
10 0.25
11 0.24
12 0.2
13 0.17
14 0.16
15 0.17
16 0.17
17 0.19
18 0.17
19 0.18
20 0.18
21 0.18
22 0.17
23 0.27
24 0.34
25 0.35
26 0.37
27 0.36
28 0.36
29 0.37
30 0.41
31 0.33
32 0.3
33 0.28
34 0.27
35 0.27
36 0.26
37 0.24
38 0.18
39 0.15
40 0.1
41 0.1
42 0.09
43 0.08
44 0.1
45 0.09
46 0.09
47 0.1
48 0.1
49 0.14
50 0.18
51 0.19
52 0.19
53 0.2
54 0.2
55 0.2
56 0.21
57 0.18
58 0.14
59 0.13
60 0.16
61 0.2
62 0.21
63 0.26
64 0.36
65 0.45
66 0.5
67 0.56
68 0.61
69 0.66
70 0.75
71 0.8
72 0.8
73 0.8
74 0.85
75 0.89
76 0.91
77 0.92
78 0.89
79 0.89
80 0.9
81 0.89
82 0.89
83 0.9
84 0.91
85 0.91