Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9S4H3

Protein Details
Accession A0A1L9S4H3    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
5-31RSPIGRRRSNSPRSIRQQQTRRRNSLLHydrophilic
NLS Segment(s)
PositionSequence
10-12RRR
Subcellular Location(s) nucl 18.5, mito_nucl 13.5, mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0006351  P:DNA-templated transcription  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
PROSITE View protein in PROSITE  
PS50066  MADS_BOX_2  
Amino Acid Sequences MAAKRSPIGRRRSNSPRSIRQQQTRRRNSLLRKSFEYCRECDADVFMMIRLRHNGQIVFFNSDSQWPLSREQLASHYPKPQEITWNELAAKYSSPKICDKSHKEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.78
3 0.79
4 0.78
5 0.83
6 0.83
7 0.83
8 0.83
9 0.84
10 0.86
11 0.85
12 0.83
13 0.79
14 0.78
15 0.77
16 0.78
17 0.77
18 0.71
19 0.67
20 0.64
21 0.64
22 0.64
23 0.58
24 0.48
25 0.43
26 0.4
27 0.35
28 0.31
29 0.26
30 0.18
31 0.15
32 0.14
33 0.1
34 0.11
35 0.11
36 0.11
37 0.12
38 0.12
39 0.13
40 0.14
41 0.14
42 0.12
43 0.16
44 0.17
45 0.19
46 0.18
47 0.17
48 0.16
49 0.16
50 0.16
51 0.14
52 0.15
53 0.13
54 0.15
55 0.16
56 0.18
57 0.18
58 0.18
59 0.21
60 0.24
61 0.27
62 0.28
63 0.32
64 0.31
65 0.32
66 0.35
67 0.32
68 0.36
69 0.32
70 0.37
71 0.34
72 0.36
73 0.34
74 0.32
75 0.32
76 0.24
77 0.24
78 0.2
79 0.24
80 0.24
81 0.27
82 0.33
83 0.36
84 0.43
85 0.52