Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9SGD3

Protein Details
Accession A0A1L9SGD3    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
55-75NESRRCIERNRDPKKTKERDGBasic
NLS Segment(s)
PositionSequence
63-71RNRDPKKTK
Subcellular Location(s) nucl 19.5, cyto_nucl 12, mito 6
Family & Domain DBs
Amino Acid Sequences MFSIVSARQSGSAKEELSREGSGNLKGKKADPAVEVVEQARMENESRAEEKRRGNESRRCIERNRDPKKTKERDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.21
4 0.24
5 0.23
6 0.19
7 0.18
8 0.2
9 0.22
10 0.27
11 0.27
12 0.25
13 0.26
14 0.26
15 0.29
16 0.29
17 0.27
18 0.21
19 0.22
20 0.22
21 0.21
22 0.21
23 0.15
24 0.15
25 0.12
26 0.11
27 0.09
28 0.07
29 0.08
30 0.08
31 0.09
32 0.1
33 0.13
34 0.16
35 0.2
36 0.25
37 0.3
38 0.36
39 0.42
40 0.47
41 0.53
42 0.58
43 0.62
44 0.67
45 0.69
46 0.66
47 0.65
48 0.68
49 0.7
50 0.73
51 0.74
52 0.75
53 0.74
54 0.8
55 0.85