Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9SLD5

Protein Details
Accession A0A1L9SLD5    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
38-57ERFQRAKKNRDEARGNRKRIBasic
NLS Segment(s)
PositionSequence
44-55KKNRDEARGNRK
Subcellular Location(s) nucl 15, cyto 6, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013892  Cyt_c_biogenesis_Cmc1-like  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Pfam View protein in Pfam  
PF08583  Cmc1  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences CEEIMTALDECHARGFLWKALGNCNEIKREVNRCLAAERFQRAKKNRDEARGNRKRIEQIWA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.15
3 0.15
4 0.19
5 0.21
6 0.21
7 0.26
8 0.27
9 0.27
10 0.28
11 0.28
12 0.25
13 0.24
14 0.25
15 0.24
16 0.28
17 0.28
18 0.29
19 0.28
20 0.27
21 0.28
22 0.28
23 0.28
24 0.27
25 0.29
26 0.32
27 0.35
28 0.43
29 0.47
30 0.54
31 0.57
32 0.63
33 0.65
34 0.68
35 0.73
36 0.74
37 0.8
38 0.81
39 0.78
40 0.74
41 0.72
42 0.71