Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9SNX8

Protein Details
Accession A0A1L9SNX8   
Localization Confidence High
Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MEIADPRWKNGRKKNPRYKSYNQNEVSHydrophilic
NLS Segment(s)
PositionSequence
12-14RKK
Subcellular Location(s) nucl 20, cyto 4, mito 2
Family & Domain DBs
Amino Acid Sequences MEIADPRWKNGRKKNPRYKSYNQNEVSAQRERERDDLRRKNTAGRRTNSFVSNLAELSPGSRVQRPASQRPPGPNWRRPGPKLFWVIVVPHQPNHHPRLCSISLTIVFPWAAPWSVFFVSMIQLIDTSWFLRVSYCPILAAPALRNLISRHYIIASK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.9
3 0.92
4 0.91
5 0.89
6 0.89
7 0.87
8 0.87
9 0.77
10 0.7
11 0.65
12 0.59
13 0.55
14 0.5
15 0.43
16 0.38
17 0.39
18 0.38
19 0.41
20 0.44
21 0.48
22 0.54
23 0.6
24 0.6
25 0.65
26 0.63
27 0.65
28 0.67
29 0.68
30 0.66
31 0.6
32 0.62
33 0.59
34 0.6
35 0.53
36 0.47
37 0.38
38 0.31
39 0.28
40 0.21
41 0.17
42 0.14
43 0.12
44 0.11
45 0.1
46 0.09
47 0.1
48 0.12
49 0.14
50 0.15
51 0.21
52 0.27
53 0.34
54 0.4
55 0.44
56 0.45
57 0.49
58 0.53
59 0.58
60 0.6
61 0.57
62 0.55
63 0.57
64 0.6
65 0.57
66 0.57
67 0.5
68 0.49
69 0.47
70 0.42
71 0.36
72 0.31
73 0.29
74 0.26
75 0.28
76 0.23
77 0.2
78 0.21
79 0.23
80 0.27
81 0.31
82 0.32
83 0.27
84 0.27
85 0.33
86 0.33
87 0.3
88 0.26
89 0.24
90 0.2
91 0.21
92 0.2
93 0.14
94 0.12
95 0.11
96 0.11
97 0.09
98 0.08
99 0.07
100 0.08
101 0.11
102 0.11
103 0.12
104 0.11
105 0.11
106 0.11
107 0.12
108 0.12
109 0.08
110 0.07
111 0.07
112 0.08
113 0.08
114 0.08
115 0.08
116 0.08
117 0.08
118 0.1
119 0.11
120 0.16
121 0.18
122 0.18
123 0.17
124 0.17
125 0.19
126 0.18
127 0.2
128 0.16
129 0.17
130 0.19
131 0.18
132 0.2
133 0.2
134 0.25
135 0.25
136 0.24
137 0.21