Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9SP86

Protein Details
Accession A0A1L9SP86   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
42-75ECTFSFQPAKKERRRRGLKKKRKRKRKRWESPEVBasic
NLS Segment(s)
PositionSequence
50-70AKKERRRRGLKKKRKRKRKRW
Subcellular Location(s) plas 16, mito 4, nucl 2, E.R. 2, golg 2
Family & Domain DBs
Amino Acid Sequences MSLILIILSISCIYSDMHLFSSLTGLMGSISRRRFSKPTTRECTFSFQPAKKERRRRGLKKKRKRKRKRWESPEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.09
4 0.1
5 0.11
6 0.11
7 0.1
8 0.11
9 0.09
10 0.08
11 0.07
12 0.06
13 0.05
14 0.06
15 0.07
16 0.11
17 0.13
18 0.15
19 0.16
20 0.2
21 0.23
22 0.27
23 0.37
24 0.4
25 0.48
26 0.54
27 0.55
28 0.55
29 0.53
30 0.55
31 0.46
32 0.45
33 0.42
34 0.38
35 0.44
36 0.5
37 0.57
38 0.6
39 0.69
40 0.72
41 0.75
42 0.83
43 0.86
44 0.89
45 0.91
46 0.93
47 0.93
48 0.96
49 0.96
50 0.96
51 0.97
52 0.96
53 0.96
54 0.97
55 0.97