Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9SVA4

Protein Details
Accession A0A1L9SVA4    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
66-86SIERRPSTREKIKQHVRRMSIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 10, cyto 3
Family & Domain DBs
Amino Acid Sequences MECFRQIVRFVKSPFQKSAAPRIIEIGPPTNFRKENMPAFFSDADTLTSHDSRGLMKDGEDQVSGSIERRPSTREKIKQHVRRMSIKINQVVPEIELA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.51
3 0.5
4 0.47
5 0.55
6 0.53
7 0.47
8 0.42
9 0.41
10 0.38
11 0.35
12 0.33
13 0.27
14 0.21
15 0.24
16 0.27
17 0.29
18 0.28
19 0.27
20 0.31
21 0.31
22 0.37
23 0.36
24 0.35
25 0.3
26 0.33
27 0.32
28 0.26
29 0.22
30 0.15
31 0.13
32 0.12
33 0.12
34 0.1
35 0.1
36 0.1
37 0.09
38 0.09
39 0.09
40 0.1
41 0.11
42 0.09
43 0.09
44 0.14
45 0.15
46 0.16
47 0.15
48 0.14
49 0.12
50 0.13
51 0.13
52 0.09
53 0.1
54 0.11
55 0.12
56 0.13
57 0.17
58 0.22
59 0.32
60 0.41
61 0.48
62 0.54
63 0.64
64 0.73
65 0.79
66 0.83
67 0.82
68 0.79
69 0.78
70 0.76
71 0.75
72 0.72
73 0.7
74 0.66
75 0.61
76 0.57
77 0.5
78 0.45