Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9SFW6

Protein Details
Accession A0A1L9SFW6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
47-70AFKAVCERRWRVRRRRRRFIAIAGHydrophilic
NLS Segment(s)
PositionSequence
55-64RWRVRRRRRR
Subcellular Location(s) plas 23, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007274  Cop_transporter  
Gene Ontology GO:0016020  C:membrane  
GO:0005375  F:copper ion transmembrane transporter activity  
GO:0006878  P:intracellular copper ion homeostasis  
Pfam View protein in Pfam  
PF04145  Ctr  
Amino Acid Sequences MSMTVVFQNEQNTSLYATAWTPSSSGSYAGTCIFLLLLSVLLRCLFAFKAVCERRWRVRRRRRRFIAIAGEQSQLQSQPDDAKIADESVRVLASRPGSVPVPWRLSVDLPRALIFLCISGVSYLLMLAVMTMNVGYFCSVLAGAFLGDLAVGRYITDDDH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.12
4 0.12
5 0.12
6 0.12
7 0.11
8 0.1
9 0.1
10 0.12
11 0.12
12 0.12
13 0.12
14 0.12
15 0.13
16 0.13
17 0.13
18 0.1
19 0.09
20 0.08
21 0.07
22 0.06
23 0.05
24 0.05
25 0.05
26 0.05
27 0.05
28 0.05
29 0.06
30 0.05
31 0.07
32 0.06
33 0.09
34 0.09
35 0.1
36 0.2
37 0.23
38 0.27
39 0.32
40 0.37
41 0.44
42 0.53
43 0.63
44 0.63
45 0.72
46 0.8
47 0.84
48 0.9
49 0.88
50 0.88
51 0.83
52 0.79
53 0.78
54 0.71
55 0.64
56 0.55
57 0.48
58 0.38
59 0.33
60 0.25
61 0.16
62 0.12
63 0.08
64 0.06
65 0.08
66 0.08
67 0.09
68 0.08
69 0.09
70 0.08
71 0.09
72 0.09
73 0.07
74 0.07
75 0.06
76 0.07
77 0.06
78 0.06
79 0.08
80 0.09
81 0.09
82 0.09
83 0.11
84 0.11
85 0.12
86 0.16
87 0.19
88 0.21
89 0.21
90 0.22
91 0.22
92 0.23
93 0.27
94 0.27
95 0.25
96 0.22
97 0.21
98 0.21
99 0.19
100 0.18
101 0.13
102 0.09
103 0.07
104 0.06
105 0.06
106 0.06
107 0.06
108 0.05
109 0.05
110 0.04
111 0.04
112 0.04
113 0.03
114 0.03
115 0.03
116 0.03
117 0.03
118 0.03
119 0.03
120 0.03
121 0.04
122 0.04
123 0.04
124 0.04
125 0.05
126 0.05
127 0.05
128 0.05
129 0.05
130 0.05
131 0.04
132 0.04
133 0.03
134 0.03
135 0.04
136 0.04
137 0.05
138 0.05
139 0.05
140 0.06