Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9SBW7

Protein Details
Accession A0A1L9SBW7    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
86-106KRSTYNPSRRVQKRRHGFLARHydrophilic
NLS Segment(s)
PositionSequence
94-125RRVQKRRHGFLARLRSRGGRNILMRRKAKGRK
Subcellular Location(s) mito 15, nucl 8, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MLNMLGLRCRALASPVRCLMFGSQMTTRLQASIPTSSTTSSIRTFSSALPSILSQGTLSRYRTAVPSALGALQTRSFSASACLAGKRSTYNPSRRVQKRRHGFLARLRSRGGRNILMRRKAKGRKFLSW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.35
3 0.36
4 0.35
5 0.36
6 0.32
7 0.3
8 0.27
9 0.24
10 0.21
11 0.23
12 0.24
13 0.24
14 0.23
15 0.18
16 0.17
17 0.15
18 0.17
19 0.17
20 0.17
21 0.17
22 0.17
23 0.17
24 0.18
25 0.17
26 0.17
27 0.16
28 0.16
29 0.15
30 0.16
31 0.16
32 0.15
33 0.19
34 0.18
35 0.16
36 0.16
37 0.15
38 0.15
39 0.14
40 0.13
41 0.08
42 0.07
43 0.11
44 0.13
45 0.14
46 0.14
47 0.14
48 0.14
49 0.15
50 0.16
51 0.13
52 0.11
53 0.1
54 0.09
55 0.09
56 0.09
57 0.08
58 0.08
59 0.08
60 0.08
61 0.07
62 0.08
63 0.08
64 0.07
65 0.09
66 0.08
67 0.09
68 0.1
69 0.11
70 0.11
71 0.11
72 0.12
73 0.13
74 0.15
75 0.21
76 0.28
77 0.36
78 0.42
79 0.48
80 0.58
81 0.65
82 0.72
83 0.74
84 0.77
85 0.79
86 0.81
87 0.83
88 0.79
89 0.77
90 0.76
91 0.78
92 0.73
93 0.66
94 0.59
95 0.55
96 0.52
97 0.53
98 0.49
99 0.46
100 0.48
101 0.56
102 0.63
103 0.67
104 0.67
105 0.66
106 0.71
107 0.73
108 0.73
109 0.73