Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9QQR4

Protein Details
Accession A0A1J9QQR4   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
359-381ETCWNSAKERCRRRGIRECSVPPHydrophilic
NLS Segment(s)
PositionSequence
260-263RRRR
Subcellular Location(s) mito 11, nucl 7.5, cyto_nucl 7.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029130  Acid_ceramidase_N  
Pfam View protein in Pfam  
PF15508  NAAA-beta  
Amino Acid Sequences MAPTTRSKSRKAAVAGFPDPTQPTNTSRMHELRPLEMRNPAQFDPVPPKYTIDLSRPPRERYNEVVADFKPQLTKLTGLFDEVLIMTGLPVKATTRFARLFLRRVRSKEETEELRGISKASGVPMHLLVSFNSLLDLFMGCTSGGARVRTGDSSTTMHHFRTLDWEMDVLRRVVVQLEFVDRPHGAVVARSVTYVGYVGVLTGVRRGLSASLNFRPYHNDDLSGSANVKFYSNLLLMLLGFRPSISSRLRELVIPRVGPRRRRDPDRKGLWDLATVKERFPALPTTAAYLIFSDGYETAVLEKDRVTATVRSSSSFIAITNCDVDATDSSDKAAKKPRAKLDLLKDLIEEAEDRRVRLETCWNSAKERCRRRGIRECSVPPEDVVKWVQRYPTTNETTHYAVVMDPKAGEVVWAKRWLEGEATQSGLDSWDQGWTCI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.62
3 0.56
4 0.51
5 0.46
6 0.42
7 0.35
8 0.31
9 0.26
10 0.28
11 0.33
12 0.36
13 0.35
14 0.4
15 0.44
16 0.44
17 0.47
18 0.46
19 0.45
20 0.49
21 0.5
22 0.45
23 0.47
24 0.47
25 0.47
26 0.49
27 0.43
28 0.41
29 0.38
30 0.4
31 0.42
32 0.43
33 0.41
34 0.36
35 0.38
36 0.35
37 0.39
38 0.39
39 0.36
40 0.41
41 0.45
42 0.55
43 0.58
44 0.6
45 0.63
46 0.65
47 0.64
48 0.61
49 0.62
50 0.57
51 0.53
52 0.53
53 0.45
54 0.45
55 0.4
56 0.35
57 0.28
58 0.23
59 0.24
60 0.21
61 0.23
62 0.19
63 0.23
64 0.22
65 0.22
66 0.22
67 0.18
68 0.17
69 0.15
70 0.14
71 0.08
72 0.08
73 0.06
74 0.08
75 0.08
76 0.07
77 0.07
78 0.08
79 0.1
80 0.15
81 0.18
82 0.22
83 0.23
84 0.26
85 0.34
86 0.38
87 0.44
88 0.47
89 0.55
90 0.54
91 0.57
92 0.62
93 0.59
94 0.59
95 0.57
96 0.56
97 0.51
98 0.5
99 0.49
100 0.42
101 0.37
102 0.33
103 0.28
104 0.2
105 0.17
106 0.13
107 0.12
108 0.12
109 0.11
110 0.12
111 0.12
112 0.13
113 0.12
114 0.11
115 0.1
116 0.12
117 0.12
118 0.1
119 0.1
120 0.09
121 0.08
122 0.08
123 0.08
124 0.05
125 0.05
126 0.06
127 0.05
128 0.05
129 0.05
130 0.09
131 0.11
132 0.11
133 0.11
134 0.12
135 0.14
136 0.15
137 0.16
138 0.13
139 0.13
140 0.14
141 0.16
142 0.18
143 0.18
144 0.18
145 0.19
146 0.19
147 0.16
148 0.22
149 0.23
150 0.2
151 0.18
152 0.19
153 0.17
154 0.18
155 0.19
156 0.11
157 0.09
158 0.08
159 0.08
160 0.09
161 0.08
162 0.08
163 0.08
164 0.11
165 0.12
166 0.12
167 0.14
168 0.12
169 0.12
170 0.11
171 0.11
172 0.07
173 0.07
174 0.09
175 0.08
176 0.09
177 0.08
178 0.08
179 0.07
180 0.07
181 0.07
182 0.06
183 0.04
184 0.04
185 0.04
186 0.04
187 0.04
188 0.04
189 0.05
190 0.05
191 0.05
192 0.05
193 0.05
194 0.06
195 0.08
196 0.1
197 0.14
198 0.16
199 0.2
200 0.2
201 0.2
202 0.23
203 0.25
204 0.28
205 0.24
206 0.23
207 0.2
208 0.23
209 0.23
210 0.19
211 0.17
212 0.12
213 0.13
214 0.11
215 0.11
216 0.08
217 0.08
218 0.1
219 0.09
220 0.08
221 0.07
222 0.07
223 0.07
224 0.07
225 0.07
226 0.05
227 0.05
228 0.04
229 0.06
230 0.06
231 0.11
232 0.12
233 0.14
234 0.16
235 0.18
236 0.19
237 0.2
238 0.21
239 0.24
240 0.25
241 0.24
242 0.25
243 0.32
244 0.36
245 0.41
246 0.45
247 0.48
248 0.53
249 0.62
250 0.7
251 0.71
252 0.76
253 0.78
254 0.79
255 0.73
256 0.69
257 0.59
258 0.54
259 0.46
260 0.39
261 0.36
262 0.31
263 0.26
264 0.24
265 0.24
266 0.19
267 0.19
268 0.19
269 0.15
270 0.17
271 0.17
272 0.18
273 0.18
274 0.18
275 0.16
276 0.13
277 0.12
278 0.09
279 0.09
280 0.07
281 0.06
282 0.07
283 0.06
284 0.06
285 0.06
286 0.08
287 0.08
288 0.08
289 0.08
290 0.09
291 0.1
292 0.11
293 0.13
294 0.14
295 0.16
296 0.23
297 0.23
298 0.23
299 0.24
300 0.23
301 0.22
302 0.19
303 0.17
304 0.12
305 0.13
306 0.12
307 0.12
308 0.11
309 0.1
310 0.1
311 0.11
312 0.09
313 0.13
314 0.14
315 0.13
316 0.14
317 0.18
318 0.19
319 0.22
320 0.31
321 0.34
322 0.41
323 0.5
324 0.58
325 0.61
326 0.66
327 0.69
328 0.68
329 0.7
330 0.64
331 0.56
332 0.47
333 0.4
334 0.35
335 0.28
336 0.2
337 0.11
338 0.18
339 0.18
340 0.18
341 0.19
342 0.21
343 0.21
344 0.23
345 0.32
346 0.27
347 0.34
348 0.41
349 0.41
350 0.45
351 0.5
352 0.57
353 0.57
354 0.63
355 0.64
356 0.68
357 0.74
358 0.79
359 0.84
360 0.83
361 0.84
362 0.83
363 0.8
364 0.77
365 0.73
366 0.63
367 0.53
368 0.49
369 0.39
370 0.33
371 0.32
372 0.3
373 0.29
374 0.31
375 0.35
376 0.35
377 0.39
378 0.42
379 0.47
380 0.47
381 0.45
382 0.45
383 0.44
384 0.42
385 0.38
386 0.31
387 0.23
388 0.18
389 0.22
390 0.21
391 0.18
392 0.15
393 0.15
394 0.15
395 0.14
396 0.15
397 0.14
398 0.18
399 0.22
400 0.29
401 0.29
402 0.31
403 0.32
404 0.32
405 0.31
406 0.29
407 0.28
408 0.24
409 0.26
410 0.23
411 0.22
412 0.21
413 0.18
414 0.15
415 0.12
416 0.1
417 0.14