Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J9RY74

Protein Details
Accession A0A1J9RY74    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
58-77AYRDCKKQWMEARKEAKRKEBasic
NLS Segment(s)
PositionSequence
74-75KR
Subcellular Location(s) nucl 15, pero 5, cyto 3, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MAADGKPENPWTDSAASTFDGKQYSQYFDPCQEAASRSLRCLHRNGGDREMCSDYFQAYRDCKKQWMEARKEAKRKESKSFW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.18
4 0.19
5 0.18
6 0.16
7 0.15
8 0.15
9 0.19
10 0.18
11 0.21
12 0.21
13 0.24
14 0.24
15 0.24
16 0.27
17 0.22
18 0.21
19 0.18
20 0.17
21 0.18
22 0.21
23 0.19
24 0.18
25 0.24
26 0.26
27 0.27
28 0.28
29 0.29
30 0.3
31 0.37
32 0.39
33 0.4
34 0.39
35 0.37
36 0.38
37 0.37
38 0.31
39 0.25
40 0.22
41 0.16
42 0.16
43 0.17
44 0.18
45 0.19
46 0.25
47 0.29
48 0.31
49 0.35
50 0.38
51 0.45
52 0.5
53 0.56
54 0.58
55 0.63
56 0.72
57 0.75
58 0.81
59 0.79
60 0.8
61 0.79
62 0.77