Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J9S6N9

Protein Details
Accession A0A1J9S6N9    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
57-82VEPQEKKKNPKGRALKRIKYTRRFVNHydrophilic
NLS Segment(s)
PositionSequence
62-76KKKNPKGRALKRIKY
Subcellular Location(s) mito 11, nucl 9, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKMDGEKESPPGDAGRCAADWTMETPERLDADQVCIQQVEPQEKKKNPKGRALKRIKYTRRFVNVTMTGGKRKMNPNPTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.43
3 0.48
4 0.48
5 0.48
6 0.56
7 0.55
8 0.57
9 0.53
10 0.49
11 0.45
12 0.44
13 0.41
14 0.33
15 0.29
16 0.23
17 0.22
18 0.19
19 0.15
20 0.12
21 0.12
22 0.12
23 0.11
24 0.09
25 0.09
26 0.09
27 0.13
28 0.12
29 0.12
30 0.12
31 0.13
32 0.13
33 0.13
34 0.12
35 0.08
36 0.11
37 0.14
38 0.13
39 0.13
40 0.12
41 0.12
42 0.14
43 0.16
44 0.19
45 0.2
46 0.27
47 0.35
48 0.4
49 0.49
50 0.55
51 0.62
52 0.6
53 0.67
54 0.71
55 0.74
56 0.8
57 0.82
58 0.81
59 0.81
60 0.87
61 0.86
62 0.84
63 0.81
64 0.8
65 0.78
66 0.74
67 0.66
68 0.65
69 0.58
70 0.53
71 0.52
72 0.46
73 0.43
74 0.41
75 0.43
76 0.39
77 0.44
78 0.5