Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9QVY1

Protein Details
Accession A0A1J9QVY1   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
56-80WKGWGIPFWPKKKAKKQGFRKLGGKBasic
NLS Segment(s)
PositionSequence
65-80PKKKAKKQGFRKLGGK
Subcellular Location(s) extr 9, cyto 6, mito 4, E.R. 3, cyto_pero 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAFEFLAPILTPTALATVQRDPSLLGILLAVLFGLGLLVGLSVFIHYRTEKDNGTWKGWGIPFWPKKKAKKQGFRKLGGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.11
4 0.14
5 0.16
6 0.16
7 0.16
8 0.14
9 0.14
10 0.15
11 0.12
12 0.09
13 0.07
14 0.06
15 0.06
16 0.05
17 0.04
18 0.02
19 0.02
20 0.02
21 0.02
22 0.01
23 0.01
24 0.01
25 0.01
26 0.01
27 0.02
28 0.02
29 0.02
30 0.03
31 0.03
32 0.05
33 0.05
34 0.07
35 0.1
36 0.13
37 0.13
38 0.16
39 0.25
40 0.27
41 0.29
42 0.29
43 0.27
44 0.3
45 0.29
46 0.28
47 0.22
48 0.29
49 0.35
50 0.4
51 0.49
52 0.52
53 0.61
54 0.71
55 0.79
56 0.8
57 0.82
58 0.88
59 0.9
60 0.92