Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J9RDT3

Protein Details
Accession A0A1J9RDT3    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
44-65AALVAPPLRRRRRRRAAAAAATHydrophilic
NLS Segment(s)
PositionSequence
50-63PLRRRRRRRAAAAA
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MATTPISPGPGRTAQNEKPKLTRMPPTRLALVLGDVVLGRAPGAALVAPPLRRRRRRRAAAAAATAAAAAVPAQPRKGRLHRLHQEFLLDRLAARPLREGDAQQDLAHQLRRRRLDRVDEGLLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.53
3 0.58
4 0.56
5 0.55
6 0.58
7 0.59
8 0.56
9 0.58
10 0.55
11 0.56
12 0.6
13 0.59
14 0.55
15 0.49
16 0.45
17 0.35
18 0.29
19 0.21
20 0.13
21 0.1
22 0.07
23 0.07
24 0.05
25 0.05
26 0.03
27 0.03
28 0.03
29 0.03
30 0.03
31 0.03
32 0.03
33 0.05
34 0.07
35 0.09
36 0.14
37 0.23
38 0.32
39 0.42
40 0.51
41 0.6
42 0.69
43 0.76
44 0.81
45 0.82
46 0.81
47 0.76
48 0.69
49 0.58
50 0.48
51 0.38
52 0.29
53 0.18
54 0.09
55 0.04
56 0.03
57 0.04
58 0.05
59 0.06
60 0.08
61 0.09
62 0.13
63 0.2
64 0.26
65 0.35
66 0.41
67 0.51
68 0.58
69 0.65
70 0.64
71 0.59
72 0.57
73 0.48
74 0.43
75 0.35
76 0.25
77 0.18
78 0.16
79 0.2
80 0.16
81 0.16
82 0.18
83 0.17
84 0.21
85 0.22
86 0.22
87 0.21
88 0.26
89 0.26
90 0.23
91 0.23
92 0.22
93 0.23
94 0.28
95 0.29
96 0.3
97 0.37
98 0.47
99 0.49
100 0.54
101 0.58
102 0.62
103 0.65
104 0.66