Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9RWX7

Protein Details
Accession A0A1J9RWX7    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
17-40WKIPWRMSAPQKQRQRERLRAVDRHydrophilic
80-105IFARYEKKYRKGIHKLPKWTRVSQRLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRPSQPLSGGLLWKIPWRMSAPQKQRQRERLRAVDRVIATVDKALAKEGTTTKKLDRWMEEMPTEAEMLARDKYTIFARYEKKYRKGIHKLPKWTRVSQRLNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.2
4 0.23
5 0.23
6 0.19
7 0.19
8 0.21
9 0.28
10 0.35
11 0.45
12 0.5
13 0.58
14 0.66
15 0.73
16 0.78
17 0.81
18 0.81
19 0.81
20 0.8
21 0.81
22 0.77
23 0.73
24 0.66
25 0.61
26 0.52
27 0.43
28 0.35
29 0.25
30 0.19
31 0.14
32 0.13
33 0.08
34 0.08
35 0.08
36 0.07
37 0.07
38 0.09
39 0.12
40 0.15
41 0.16
42 0.18
43 0.18
44 0.22
45 0.25
46 0.26
47 0.26
48 0.27
49 0.27
50 0.28
51 0.27
52 0.25
53 0.22
54 0.19
55 0.16
56 0.11
57 0.09
58 0.07
59 0.09
60 0.08
61 0.08
62 0.07
63 0.08
64 0.1
65 0.12
66 0.16
67 0.16
68 0.23
69 0.28
70 0.35
71 0.45
72 0.52
73 0.56
74 0.61
75 0.66
76 0.7
77 0.75
78 0.78
79 0.79
80 0.8
81 0.84
82 0.85
83 0.87
84 0.82
85 0.8
86 0.8
87 0.8
88 0.8
89 0.77
90 0.79