Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8BEK9

Protein Details
Accession G8BEK9    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
4-25SLKINLKKKAGPKKLLKQEPTDHydrophilic
NLS Segment(s)
PositionSequence
10-17KKKAGPKK
177-182KRRKKH
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR026822  Spp2/MOS2_G-patch  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF12656  G-patch_2  
Amino Acid Sequences MSTSLKINLKKKAGPKKLLKQEPTDESKTLIESYTATKANQNQTEEWVIKPKKISRSIIQPQEPKKKESQDKLQYGVTTFEKPEPVRTTPVIRKLTYESDSDDEEEDDEKKKIPVEEFGAAFLRGLGWDGKKDDQDTFDEDVKNRQRGVTLGIGAKPIDNDLARELQSQVGDVPLVKRRKKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.77
3 0.8
4 0.85
5 0.88
6 0.83
7 0.8
8 0.77
9 0.75
10 0.72
11 0.66
12 0.55
13 0.48
14 0.44
15 0.38
16 0.31
17 0.23
18 0.16
19 0.13
20 0.16
21 0.18
22 0.19
23 0.18
24 0.21
25 0.27
26 0.34
27 0.38
28 0.38
29 0.34
30 0.36
31 0.41
32 0.38
33 0.33
34 0.35
35 0.3
36 0.3
37 0.34
38 0.36
39 0.4
40 0.45
41 0.49
42 0.44
43 0.54
44 0.6
45 0.64
46 0.65
47 0.64
48 0.65
49 0.71
50 0.68
51 0.61
52 0.59
53 0.59
54 0.6
55 0.61
56 0.63
57 0.62
58 0.63
59 0.62
60 0.58
61 0.49
62 0.42
63 0.37
64 0.28
65 0.2
66 0.17
67 0.16
68 0.17
69 0.17
70 0.21
71 0.22
72 0.22
73 0.24
74 0.25
75 0.3
76 0.3
77 0.39
78 0.37
79 0.33
80 0.33
81 0.33
82 0.36
83 0.31
84 0.28
85 0.22
86 0.2
87 0.2
88 0.19
89 0.16
90 0.12
91 0.11
92 0.11
93 0.1
94 0.1
95 0.1
96 0.1
97 0.1
98 0.12
99 0.13
100 0.14
101 0.16
102 0.18
103 0.21
104 0.21
105 0.21
106 0.2
107 0.18
108 0.17
109 0.13
110 0.09
111 0.06
112 0.07
113 0.08
114 0.08
115 0.1
116 0.13
117 0.15
118 0.17
119 0.19
120 0.2
121 0.2
122 0.21
123 0.24
124 0.25
125 0.26
126 0.27
127 0.26
128 0.33
129 0.38
130 0.38
131 0.35
132 0.31
133 0.29
134 0.28
135 0.32
136 0.27
137 0.24
138 0.24
139 0.24
140 0.25
141 0.23
142 0.23
143 0.18
144 0.15
145 0.15
146 0.12
147 0.13
148 0.15
149 0.18
150 0.19
151 0.2
152 0.2
153 0.19
154 0.19
155 0.18
156 0.15
157 0.13
158 0.12
159 0.12
160 0.15
161 0.21
162 0.3