Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J9RB44

Protein Details
Accession A0A1J9RB44    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPSQKSFRTKQKLAKAQKQNRPIPQWHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, cyto_nucl 6.5, nucl 6, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
Amino Acid Sequences MPSQKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRFVALTADSSGTPTDCGKESPAVGDGKHDGSIADIFTTVQVQRQEEALAQDPHRHLSYSPTPATSPSSALKSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.86
3 0.86
4 0.87
5 0.88
6 0.85
7 0.83
8 0.8
9 0.78
10 0.73
11 0.72
12 0.72
13 0.66
14 0.63
15 0.58
16 0.55
17 0.53
18 0.55
19 0.51
20 0.44
21 0.41
22 0.35
23 0.32
24 0.29
25 0.23
26 0.15
27 0.11
28 0.09
29 0.09
30 0.08
31 0.09
32 0.08
33 0.07
34 0.08
35 0.07
36 0.08
37 0.07
38 0.08
39 0.09
40 0.1
41 0.09
42 0.09
43 0.12
44 0.11
45 0.1
46 0.11
47 0.11
48 0.11
49 0.12
50 0.11
51 0.08
52 0.08
53 0.09
54 0.08
55 0.06
56 0.06
57 0.05
58 0.06
59 0.07
60 0.06
61 0.09
62 0.12
63 0.13
64 0.13
65 0.14
66 0.14
67 0.14
68 0.17
69 0.19
70 0.21
71 0.21
72 0.26
73 0.26
74 0.29
75 0.28
76 0.26
77 0.21
78 0.26
79 0.32
80 0.34
81 0.35
82 0.34
83 0.33
84 0.35
85 0.39
86 0.33
87 0.29
88 0.25