Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J9RQC7

Protein Details
Accession A0A1J9RQC7    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
27-52DYRLFASSRPHRRSKHVRSGSPDSIEHydrophilic
73-95SLLSADKQPKRRQRELRLLGFRTHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 24, pero 1, E.R. 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR026841  Aur1/Ipt1  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF14378  PAP2_3  
CDD cd03386  PAP2_Aur1_like  
Amino Acid Sequences MGAGAFIEPLVVVSLLFGGTWLNRNPDYRLFASSRPHRRSKHVRSGSPDSIESGFESPTDADGLLSPRASSPSLLSADKQPKRRQRELRLLGFRTTVTSPNTRVFQDRFLSRLLQKFPFLVEAWYWALIYWVYQLGRAFTALTLVEDTVNVARKHALQLIHIEQKLHIFWELPVQHFFLQYPTLMTWINRIYSFIHIPGTILFLVWLYYFTTTRNRLNERQLGKPAGSIEGSPAGPALYEARRRTMAVCNLIAFIVFTLWPCMPPRLLSDKNVKGPVGDEARKFGFVDTVHGEGGESSVWTQNKFCNQYAAMPSLHFGYSLLIGLTILTIPLPPHQRRGLSIRLTNSLSLRLPSLRRTLSIVVGVAYPLTILVAIVATANHFILDAVAGAIVCGLAWTGNGVLLNLMPLEDWFLWCVRIHKPESKTVKWMEGGEDDEEWVVGKGVLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.05
4 0.05
5 0.05
6 0.07
7 0.12
8 0.14
9 0.19
10 0.22
11 0.25
12 0.3
13 0.35
14 0.4
15 0.37
16 0.41
17 0.39
18 0.41
19 0.49
20 0.54
21 0.59
22 0.6
23 0.67
24 0.66
25 0.73
26 0.79
27 0.8
28 0.82
29 0.81
30 0.8
31 0.8
32 0.84
33 0.8
34 0.73
35 0.63
36 0.54
37 0.45
38 0.39
39 0.32
40 0.24
41 0.18
42 0.14
43 0.15
44 0.12
45 0.11
46 0.12
47 0.1
48 0.09
49 0.1
50 0.13
51 0.13
52 0.13
53 0.12
54 0.12
55 0.14
56 0.15
57 0.14
58 0.13
59 0.17
60 0.2
61 0.21
62 0.22
63 0.29
64 0.38
65 0.44
66 0.51
67 0.55
68 0.61
69 0.7
70 0.78
71 0.8
72 0.8
73 0.85
74 0.86
75 0.86
76 0.86
77 0.8
78 0.71
79 0.62
80 0.52
81 0.44
82 0.36
83 0.3
84 0.25
85 0.26
86 0.27
87 0.3
88 0.32
89 0.3
90 0.34
91 0.32
92 0.34
93 0.35
94 0.34
95 0.31
96 0.31
97 0.34
98 0.32
99 0.37
100 0.35
101 0.32
102 0.32
103 0.31
104 0.29
105 0.28
106 0.24
107 0.19
108 0.15
109 0.15
110 0.15
111 0.15
112 0.14
113 0.11
114 0.11
115 0.09
116 0.09
117 0.07
118 0.08
119 0.08
120 0.1
121 0.1
122 0.11
123 0.11
124 0.11
125 0.11
126 0.08
127 0.09
128 0.08
129 0.08
130 0.07
131 0.07
132 0.07
133 0.06
134 0.08
135 0.08
136 0.14
137 0.13
138 0.13
139 0.14
140 0.15
141 0.17
142 0.2
143 0.19
144 0.15
145 0.2
146 0.24
147 0.3
148 0.29
149 0.27
150 0.24
151 0.25
152 0.24
153 0.19
154 0.14
155 0.09
156 0.09
157 0.16
158 0.17
159 0.17
160 0.18
161 0.19
162 0.19
163 0.19
164 0.19
165 0.12
166 0.12
167 0.1
168 0.1
169 0.09
170 0.09
171 0.1
172 0.09
173 0.11
174 0.12
175 0.13
176 0.12
177 0.13
178 0.13
179 0.15
180 0.16
181 0.14
182 0.13
183 0.12
184 0.12
185 0.11
186 0.11
187 0.08
188 0.07
189 0.06
190 0.05
191 0.06
192 0.05
193 0.06
194 0.04
195 0.06
196 0.06
197 0.07
198 0.13
199 0.16
200 0.2
201 0.25
202 0.3
203 0.33
204 0.39
205 0.45
206 0.43
207 0.44
208 0.44
209 0.4
210 0.35
211 0.32
212 0.26
213 0.2
214 0.17
215 0.13
216 0.09
217 0.1
218 0.1
219 0.08
220 0.08
221 0.06
222 0.06
223 0.06
224 0.08
225 0.09
226 0.15
227 0.15
228 0.18
229 0.19
230 0.19
231 0.22
232 0.25
233 0.27
234 0.25
235 0.25
236 0.23
237 0.23
238 0.22
239 0.2
240 0.13
241 0.08
242 0.05
243 0.04
244 0.04
245 0.06
246 0.06
247 0.07
248 0.08
249 0.1
250 0.1
251 0.11
252 0.15
253 0.21
254 0.24
255 0.27
256 0.35
257 0.39
258 0.44
259 0.45
260 0.4
261 0.32
262 0.31
263 0.32
264 0.29
265 0.28
266 0.23
267 0.24
268 0.25
269 0.26
270 0.25
271 0.2
272 0.16
273 0.13
274 0.16
275 0.15
276 0.16
277 0.15
278 0.15
279 0.14
280 0.11
281 0.11
282 0.07
283 0.05
284 0.05
285 0.09
286 0.1
287 0.11
288 0.12
289 0.15
290 0.22
291 0.27
292 0.27
293 0.27
294 0.27
295 0.32
296 0.34
297 0.33
298 0.26
299 0.22
300 0.22
301 0.19
302 0.18
303 0.13
304 0.1
305 0.08
306 0.08
307 0.08
308 0.07
309 0.06
310 0.05
311 0.05
312 0.05
313 0.04
314 0.04
315 0.03
316 0.04
317 0.05
318 0.1
319 0.18
320 0.2
321 0.26
322 0.3
323 0.32
324 0.35
325 0.4
326 0.44
327 0.42
328 0.45
329 0.43
330 0.43
331 0.43
332 0.41
333 0.37
334 0.32
335 0.26
336 0.22
337 0.21
338 0.21
339 0.22
340 0.24
341 0.3
342 0.28
343 0.28
344 0.32
345 0.32
346 0.29
347 0.29
348 0.25
349 0.19
350 0.18
351 0.16
352 0.12
353 0.09
354 0.07
355 0.04
356 0.04
357 0.03
358 0.03
359 0.03
360 0.03
361 0.03
362 0.04
363 0.04
364 0.04
365 0.05
366 0.06
367 0.05
368 0.05
369 0.05
370 0.05
371 0.05
372 0.05
373 0.04
374 0.05
375 0.04
376 0.04
377 0.04
378 0.04
379 0.03
380 0.03
381 0.03
382 0.03
383 0.03
384 0.04
385 0.04
386 0.06
387 0.06
388 0.06
389 0.07
390 0.07
391 0.07
392 0.06
393 0.06
394 0.05
395 0.05
396 0.09
397 0.09
398 0.1
399 0.11
400 0.12
401 0.13
402 0.15
403 0.19
404 0.21
405 0.29
406 0.34
407 0.41
408 0.45
409 0.53
410 0.61
411 0.62
412 0.64
413 0.61
414 0.61
415 0.56
416 0.53
417 0.47
418 0.42
419 0.4
420 0.34
421 0.3
422 0.24
423 0.2
424 0.18
425 0.15
426 0.12
427 0.1