Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9QYU7

Protein Details
Accession A0A1J9QYU7   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
83-108AAGPARPPSRMQRKPKPQGPWPRDAGHydrophilic
NLS Segment(s)
PositionSequence
84-101AGPARPPSRMQRKPKPQG
Subcellular Location(s) mito 17, cyto 4, nucl 3, plas 2
Family & Domain DBs
Amino Acid Sequences MGLLRAATTFSVKDFTVSATTWLTISFRPFLQQAVFFVFNSFFPIMFRANKRVASSSTTASASSSSPAAGGMDVMEVTRPRSAAGPARPPSRMQRKPKPQGPWPRDAGGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.15
4 0.15
5 0.16
6 0.14
7 0.15
8 0.14
9 0.14
10 0.13
11 0.12
12 0.14
13 0.13
14 0.12
15 0.14
16 0.15
17 0.16
18 0.16
19 0.16
20 0.15
21 0.18
22 0.19
23 0.17
24 0.17
25 0.16
26 0.14
27 0.17
28 0.16
29 0.1
30 0.09
31 0.11
32 0.13
33 0.16
34 0.18
35 0.19
36 0.22
37 0.24
38 0.25
39 0.25
40 0.24
41 0.24
42 0.24
43 0.2
44 0.19
45 0.18
46 0.16
47 0.14
48 0.14
49 0.1
50 0.09
51 0.08
52 0.06
53 0.06
54 0.06
55 0.06
56 0.05
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.05
63 0.05
64 0.07
65 0.07
66 0.08
67 0.08
68 0.1
69 0.13
70 0.2
71 0.26
72 0.34
73 0.39
74 0.42
75 0.43
76 0.45
77 0.52
78 0.56
79 0.59
80 0.6
81 0.66
82 0.73
83 0.83
84 0.87
85 0.86
86 0.85
87 0.86
88 0.84
89 0.81
90 0.75