Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9RYJ6

Protein Details
Accession A0A1J9RYJ6   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
20-46SQQHHPGGRPRRQPRSQAAHNHKQFRNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR027915  DUF4452  
Pfam View protein in Pfam  
PF14618  DUF4452  
Amino Acid Sequences MSTSNFYYGAPHHNIHMNHSQQHHPGGRPRRQPRSQAAHNHKQFRNVRTPKEVVEAPAILAFRRDFEAARSFDLEDDEIFCPFHLLTDDDLQSIHSSGSDRSSLSSGSPDSSPLQHQLQPTPSFVLSSASSSFTPASFQPSQTKLHQPLAQRTRNAIPIVDPSTRNVASPPPSVSPARQMQQQFMPRRW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.36
3 0.42
4 0.39
5 0.4
6 0.43
7 0.46
8 0.42
9 0.49
10 0.48
11 0.44
12 0.49
13 0.54
14 0.59
15 0.65
16 0.71
17 0.74
18 0.76
19 0.8
20 0.8
21 0.8
22 0.79
23 0.8
24 0.8
25 0.8
26 0.81
27 0.82
28 0.74
29 0.74
30 0.71
31 0.67
32 0.68
33 0.65
34 0.63
35 0.61
36 0.62
37 0.54
38 0.52
39 0.46
40 0.37
41 0.33
42 0.27
43 0.2
44 0.2
45 0.18
46 0.13
47 0.14
48 0.11
49 0.09
50 0.11
51 0.11
52 0.09
53 0.12
54 0.19
55 0.18
56 0.2
57 0.2
58 0.18
59 0.18
60 0.18
61 0.16
62 0.1
63 0.11
64 0.1
65 0.09
66 0.09
67 0.08
68 0.08
69 0.07
70 0.08
71 0.06
72 0.06
73 0.08
74 0.11
75 0.11
76 0.1
77 0.11
78 0.11
79 0.1
80 0.09
81 0.07
82 0.05
83 0.05
84 0.06
85 0.07
86 0.08
87 0.08
88 0.08
89 0.09
90 0.09
91 0.08
92 0.1
93 0.09
94 0.09
95 0.09
96 0.1
97 0.11
98 0.12
99 0.13
100 0.15
101 0.17
102 0.18
103 0.19
104 0.21
105 0.26
106 0.26
107 0.26
108 0.24
109 0.22
110 0.19
111 0.18
112 0.17
113 0.12
114 0.13
115 0.13
116 0.13
117 0.13
118 0.14
119 0.14
120 0.11
121 0.13
122 0.11
123 0.17
124 0.16
125 0.19
126 0.23
127 0.26
128 0.3
129 0.33
130 0.4
131 0.38
132 0.43
133 0.45
134 0.44
135 0.52
136 0.57
137 0.59
138 0.53
139 0.53
140 0.5
141 0.51
142 0.47
143 0.37
144 0.3
145 0.3
146 0.33
147 0.32
148 0.29
149 0.26
150 0.32
151 0.31
152 0.3
153 0.25
154 0.26
155 0.27
156 0.3
157 0.31
158 0.28
159 0.32
160 0.34
161 0.35
162 0.37
163 0.39
164 0.39
165 0.42
166 0.41
167 0.43
168 0.49
169 0.56