Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J9R8R5

Protein Details
Accession A0A1J9R8R5    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
10-31AVPKGASPKKSRRLLRLGPPIQHydrophilic
NLS Segment(s)
PositionSequence
17-22PKKSRR
Subcellular Location(s) mito 14.5, cyto_mito 8.5, nucl 5, extr 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000571  Znf_CCCH  
IPR036855  Znf_CCCH_sf  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF00642  zf-CCCH  
PROSITE View protein in PROSITE  
PS50103  ZF_C3H1  
Amino Acid Sequences MQRAFASAAAVPKGASPKKSRRLLRLGPPIQSRLADNGRQPPSPAHPQPATRLPSLVTARLHDAPPRRAMAVCKFFLQGNCKFGDRCKFDHPGAQNQHRGNQQTQNRFAPLNNANTGGQGGRGPQRGPRQDFKYNLDPDIVHVDLTSDRPIWPFSVYAPGRTAPRHLIEGPIMEQSPEEMRLRYYGAAQSGNPQEAAQQETQLLGEMNQQIQNILGDLTGACRYVQEGENVHPNRLDNTSGAPGQQQQQQAGTFARGNAGVGQPSAFGAAKPAFGQPGGFSSVPSQQQSAFGAPSQPQGAFGRPSAFGASANQPSAFGAPSALGGGAANPAFGKPAFGAPSAFGQAANAGSTAGAAPAFGQPSQPSAFGQPGGGAFGAKPGFGQPAGGSAFGQPSQPGGTGAFGRPTGTPGFGQSGFGQAAQQTGANGFAQLGQQQQQNQQAGGFGQASNQQSGVGAFGQQQQQQQQQPAANAFGQPAAKPSPFGAPAQQAAPSAFGAPAQQAAPSAFGAPVQQAAPSAFGAPAQQAAPSAFGQSSMNGLSAPQANGFGQRPPQSNPTPNVAAGADVSSYTTRGNNNQLLSWKGQPVQYIDGNPYYRRPDNGAWERIWLPDGPPAENPYCYAKPEVYGEVLKEAYEYLNRTGSFKDGVMPEEPPIHAAVRWDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.34
3 0.39
4 0.49
5 0.59
6 0.68
7 0.73
8 0.73
9 0.79
10 0.82
11 0.83
12 0.83
13 0.79
14 0.77
15 0.75
16 0.69
17 0.61
18 0.54
19 0.45
20 0.42
21 0.43
22 0.4
23 0.4
24 0.46
25 0.48
26 0.48
27 0.47
28 0.44
29 0.45
30 0.51
31 0.5
32 0.48
33 0.49
34 0.52
35 0.57
36 0.6
37 0.57
38 0.48
39 0.45
40 0.38
41 0.41
42 0.4
43 0.39
44 0.32
45 0.3
46 0.33
47 0.35
48 0.36
49 0.34
50 0.39
51 0.39
52 0.42
53 0.42
54 0.39
55 0.38
56 0.42
57 0.46
58 0.46
59 0.42
60 0.39
61 0.38
62 0.39
63 0.42
64 0.43
65 0.38
66 0.34
67 0.34
68 0.34
69 0.34
70 0.37
71 0.42
72 0.41
73 0.41
74 0.44
75 0.47
76 0.47
77 0.54
78 0.53
79 0.53
80 0.58
81 0.6
82 0.61
83 0.58
84 0.62
85 0.6
86 0.59
87 0.54
88 0.54
89 0.55
90 0.56
91 0.6
92 0.58
93 0.55
94 0.52
95 0.47
96 0.46
97 0.43
98 0.4
99 0.35
100 0.33
101 0.31
102 0.3
103 0.3
104 0.22
105 0.17
106 0.12
107 0.14
108 0.17
109 0.2
110 0.21
111 0.26
112 0.36
113 0.44
114 0.5
115 0.55
116 0.56
117 0.61
118 0.66
119 0.66
120 0.66
121 0.59
122 0.54
123 0.47
124 0.4
125 0.34
126 0.34
127 0.28
128 0.18
129 0.15
130 0.15
131 0.14
132 0.16
133 0.16
134 0.11
135 0.12
136 0.13
137 0.14
138 0.14
139 0.14
140 0.13
141 0.12
142 0.21
143 0.21
144 0.22
145 0.23
146 0.24
147 0.26
148 0.26
149 0.29
150 0.23
151 0.25
152 0.27
153 0.25
154 0.26
155 0.24
156 0.25
157 0.23
158 0.21
159 0.18
160 0.14
161 0.14
162 0.12
163 0.13
164 0.14
165 0.14
166 0.12
167 0.12
168 0.14
169 0.15
170 0.15
171 0.15
172 0.15
173 0.16
174 0.17
175 0.16
176 0.21
177 0.22
178 0.22
179 0.2
180 0.18
181 0.17
182 0.17
183 0.21
184 0.15
185 0.13
186 0.13
187 0.13
188 0.13
189 0.12
190 0.1
191 0.07
192 0.11
193 0.11
194 0.13
195 0.14
196 0.14
197 0.13
198 0.13
199 0.13
200 0.09
201 0.08
202 0.06
203 0.04
204 0.04
205 0.06
206 0.06
207 0.06
208 0.06
209 0.06
210 0.07
211 0.1
212 0.11
213 0.12
214 0.14
215 0.15
216 0.25
217 0.26
218 0.26
219 0.24
220 0.23
221 0.22
222 0.22
223 0.21
224 0.12
225 0.14
226 0.16
227 0.16
228 0.16
229 0.14
230 0.15
231 0.17
232 0.21
233 0.2
234 0.18
235 0.2
236 0.2
237 0.21
238 0.19
239 0.18
240 0.14
241 0.12
242 0.12
243 0.1
244 0.1
245 0.1
246 0.1
247 0.08
248 0.08
249 0.08
250 0.07
251 0.07
252 0.08
253 0.06
254 0.05
255 0.08
256 0.08
257 0.09
258 0.1
259 0.1
260 0.09
261 0.09
262 0.09
263 0.07
264 0.08
265 0.11
266 0.1
267 0.1
268 0.12
269 0.16
270 0.18
271 0.18
272 0.17
273 0.14
274 0.15
275 0.17
276 0.16
277 0.12
278 0.1
279 0.11
280 0.11
281 0.12
282 0.12
283 0.1
284 0.11
285 0.12
286 0.14
287 0.13
288 0.13
289 0.14
290 0.13
291 0.14
292 0.12
293 0.11
294 0.1
295 0.11
296 0.14
297 0.13
298 0.13
299 0.13
300 0.12
301 0.12
302 0.12
303 0.1
304 0.06
305 0.05
306 0.05
307 0.05
308 0.05
309 0.04
310 0.04
311 0.03
312 0.03
313 0.04
314 0.04
315 0.04
316 0.04
317 0.04
318 0.05
319 0.05
320 0.05
321 0.04
322 0.06
323 0.08
324 0.08
325 0.09
326 0.09
327 0.1
328 0.1
329 0.1
330 0.08
331 0.07
332 0.07
333 0.07
334 0.06
335 0.05
336 0.04
337 0.04
338 0.04
339 0.04
340 0.03
341 0.03
342 0.03
343 0.04
344 0.05
345 0.06
346 0.05
347 0.06
348 0.06
349 0.09
350 0.1
351 0.1
352 0.09
353 0.1
354 0.11
355 0.11
356 0.1
357 0.09
358 0.08
359 0.08
360 0.07
361 0.06
362 0.05
363 0.08
364 0.08
365 0.07
366 0.07
367 0.07
368 0.08
369 0.08
370 0.08
371 0.05
372 0.09
373 0.09
374 0.1
375 0.09
376 0.09
377 0.1
378 0.1
379 0.1
380 0.07
381 0.07
382 0.07
383 0.07
384 0.07
385 0.07
386 0.08
387 0.09
388 0.09
389 0.1
390 0.09
391 0.1
392 0.1
393 0.11
394 0.11
395 0.11
396 0.11
397 0.11
398 0.14
399 0.13
400 0.15
401 0.13
402 0.14
403 0.13
404 0.13
405 0.12
406 0.09
407 0.09
408 0.08
409 0.08
410 0.06
411 0.06
412 0.07
413 0.06
414 0.06
415 0.06
416 0.06
417 0.07
418 0.07
419 0.09
420 0.1
421 0.13
422 0.15
423 0.2
424 0.25
425 0.25
426 0.25
427 0.23
428 0.21
429 0.19
430 0.18
431 0.15
432 0.08
433 0.09
434 0.13
435 0.14
436 0.14
437 0.14
438 0.12
439 0.12
440 0.12
441 0.12
442 0.07
443 0.07
444 0.08
445 0.12
446 0.15
447 0.18
448 0.2
449 0.23
450 0.29
451 0.32
452 0.33
453 0.34
454 0.32
455 0.32
456 0.31
457 0.29
458 0.23
459 0.2
460 0.18
461 0.16
462 0.15
463 0.12
464 0.14
465 0.15
466 0.15
467 0.15
468 0.16
469 0.18
470 0.19
471 0.2
472 0.21
473 0.2
474 0.22
475 0.22
476 0.22
477 0.18
478 0.16
479 0.17
480 0.13
481 0.11
482 0.1
483 0.09
484 0.08
485 0.08
486 0.09
487 0.08
488 0.08
489 0.08
490 0.08
491 0.09
492 0.09
493 0.09
494 0.08
495 0.08
496 0.09
497 0.08
498 0.09
499 0.08
500 0.08
501 0.08
502 0.09
503 0.1
504 0.09
505 0.1
506 0.08
507 0.08
508 0.09
509 0.08
510 0.09
511 0.08
512 0.08
513 0.08
514 0.08
515 0.11
516 0.1
517 0.11
518 0.1
519 0.11
520 0.11
521 0.11
522 0.12
523 0.1
524 0.1
525 0.08
526 0.09
527 0.1
528 0.12
529 0.13
530 0.11
531 0.12
532 0.13
533 0.17
534 0.18
535 0.18
536 0.22
537 0.27
538 0.3
539 0.32
540 0.4
541 0.43
542 0.49
543 0.49
544 0.5
545 0.47
546 0.43
547 0.41
548 0.34
549 0.27
550 0.2
551 0.18
552 0.11
553 0.08
554 0.1
555 0.08
556 0.09
557 0.1
558 0.12
559 0.14
560 0.19
561 0.26
562 0.3
563 0.31
564 0.33
565 0.36
566 0.37
567 0.37
568 0.37
569 0.33
570 0.31
571 0.32
572 0.31
573 0.32
574 0.33
575 0.33
576 0.31
577 0.31
578 0.34
579 0.35
580 0.34
581 0.35
582 0.37
583 0.36
584 0.37
585 0.4
586 0.39
587 0.47
588 0.55
589 0.55
590 0.49
591 0.5
592 0.49
593 0.43
594 0.4
595 0.3
596 0.22
597 0.22
598 0.23
599 0.21
600 0.23
601 0.27
602 0.28
603 0.28
604 0.28
605 0.31
606 0.31
607 0.31
608 0.32
609 0.27
610 0.28
611 0.31
612 0.32
613 0.28
614 0.28
615 0.27
616 0.27
617 0.26
618 0.23
619 0.19
620 0.17
621 0.15
622 0.17
623 0.19
624 0.18
625 0.24
626 0.24
627 0.26
628 0.26
629 0.27
630 0.26
631 0.23
632 0.26
633 0.22
634 0.25
635 0.25
636 0.25
637 0.25
638 0.26
639 0.26
640 0.21
641 0.21
642 0.19
643 0.18