Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8B8N5

Protein Details
Accession G8B8N5    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
320-345KGEVIKKPSIKKPRRVYNPKFKEEEDBasic
NLS Segment(s)
PositionSequence
325-334KKPSIKKPRR
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR030379  G_SEPTIN_dom  
IPR027417  P-loop_NTPase  
IPR016491  Septin  
Gene Ontology GO:0005621  C:cellular bud scar  
GO:1990317  C:Gin4 complex  
GO:0005937  C:mating projection  
GO:0031105  C:septin complex  
GO:0032160  C:septin filament array  
GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
GO:0060090  F:molecular adaptor activity  
GO:0070273  F:phosphatidylinositol-4-phosphate binding  
GO:0010314  F:phosphatidylinositol-5-phosphate binding  
GO:0005200  F:structural constituent of cytoskeleton  
GO:0030011  P:maintenance of cell polarity  
GO:1903475  P:mitotic actomyosin contractile ring assembly  
GO:0071902  P:positive regulation of protein serine/threonine kinase activity  
GO:0000921  P:septin ring assembly  
Pfam View protein in Pfam  
PF00735  Septin  
PROSITE View protein in PROSITE  
PS51719  G_SEPTIN  
CDD cd01850  CDC_Septin  
Amino Acid Sequences MPEPVGVANLPNQRYKIVSKDGATFTIMVAGESGLGKTTFINTLFQTSLKPHQDPRNRHNKFTSSHQTVEIDIVRAILEEKNFKIRLNIIDTPGFGNNVNNNDSWVPIIDFIDDQHESFMRQEQQPSRLAKKDLRVHACLYFIRPTGHSLKPLDIEVMKRLSTRVNLIPVIAKADTLSPQEMDTFKNRIREIIEVQDINIYTPPLELDDPASAEHAKQLIEAMPFSIIGSEEDVEIAPGQFARGRKYPWGVVEIENDQHCDFKKLRSLLLRTNMLDLILSTNELHYETFRAIKLGGDEGENNGLNGGGEDGSTEELINEKGEVIKKPSIKKPRRVYNPKFKEEEDALKKFFTEQVKAEEQRFRQWETNIINERNRLNQDLEEMQSKLKSLEEQVKKLQINKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.36
3 0.37
4 0.38
5 0.42
6 0.41
7 0.47
8 0.48
9 0.45
10 0.43
11 0.36
12 0.27
13 0.26
14 0.23
15 0.16
16 0.13
17 0.12
18 0.11
19 0.11
20 0.11
21 0.07
22 0.07
23 0.08
24 0.08
25 0.1
26 0.13
27 0.13
28 0.16
29 0.16
30 0.2
31 0.21
32 0.21
33 0.21
34 0.22
35 0.3
36 0.33
37 0.36
38 0.39
39 0.49
40 0.58
41 0.65
42 0.7
43 0.73
44 0.71
45 0.73
46 0.73
47 0.7
48 0.64
49 0.65
50 0.65
51 0.6
52 0.59
53 0.56
54 0.49
55 0.43
56 0.43
57 0.35
58 0.26
59 0.19
60 0.17
61 0.13
62 0.12
63 0.13
64 0.11
65 0.12
66 0.14
67 0.16
68 0.24
69 0.25
70 0.25
71 0.27
72 0.28
73 0.31
74 0.35
75 0.37
76 0.33
77 0.33
78 0.34
79 0.33
80 0.3
81 0.25
82 0.18
83 0.18
84 0.18
85 0.19
86 0.21
87 0.18
88 0.2
89 0.19
90 0.19
91 0.16
92 0.14
93 0.11
94 0.1
95 0.1
96 0.09
97 0.09
98 0.09
99 0.13
100 0.12
101 0.11
102 0.12
103 0.12
104 0.12
105 0.13
106 0.17
107 0.18
108 0.19
109 0.26
110 0.29
111 0.33
112 0.38
113 0.43
114 0.43
115 0.43
116 0.46
117 0.43
118 0.48
119 0.52
120 0.55
121 0.55
122 0.52
123 0.5
124 0.47
125 0.45
126 0.37
127 0.32
128 0.26
129 0.22
130 0.21
131 0.19
132 0.21
133 0.24
134 0.25
135 0.27
136 0.25
137 0.26
138 0.25
139 0.25
140 0.23
141 0.18
142 0.18
143 0.17
144 0.17
145 0.16
146 0.15
147 0.15
148 0.15
149 0.15
150 0.18
151 0.18
152 0.19
153 0.19
154 0.19
155 0.2
156 0.18
157 0.19
158 0.14
159 0.12
160 0.09
161 0.09
162 0.1
163 0.1
164 0.11
165 0.09
166 0.09
167 0.11
168 0.11
169 0.12
170 0.14
171 0.17
172 0.18
173 0.23
174 0.23
175 0.23
176 0.24
177 0.25
178 0.24
179 0.24
180 0.24
181 0.19
182 0.19
183 0.19
184 0.17
185 0.15
186 0.13
187 0.08
188 0.06
189 0.06
190 0.06
191 0.05
192 0.06
193 0.05
194 0.06
195 0.07
196 0.07
197 0.07
198 0.08
199 0.07
200 0.07
201 0.08
202 0.08
203 0.07
204 0.07
205 0.07
206 0.09
207 0.09
208 0.09
209 0.08
210 0.07
211 0.07
212 0.07
213 0.07
214 0.05
215 0.04
216 0.05
217 0.05
218 0.05
219 0.05
220 0.05
221 0.05
222 0.05
223 0.05
224 0.04
225 0.04
226 0.04
227 0.07
228 0.08
229 0.12
230 0.15
231 0.17
232 0.2
233 0.24
234 0.26
235 0.25
236 0.27
237 0.25
238 0.24
239 0.25
240 0.23
241 0.23
242 0.21
243 0.2
244 0.17
245 0.17
246 0.16
247 0.17
248 0.17
249 0.17
250 0.24
251 0.24
252 0.29
253 0.34
254 0.38
255 0.4
256 0.46
257 0.47
258 0.4
259 0.41
260 0.36
261 0.29
262 0.24
263 0.18
264 0.13
265 0.09
266 0.09
267 0.07
268 0.07
269 0.07
270 0.08
271 0.08
272 0.07
273 0.08
274 0.09
275 0.11
276 0.12
277 0.12
278 0.11
279 0.12
280 0.13
281 0.13
282 0.13
283 0.12
284 0.12
285 0.13
286 0.16
287 0.15
288 0.13
289 0.11
290 0.1
291 0.09
292 0.08
293 0.08
294 0.04
295 0.04
296 0.04
297 0.05
298 0.06
299 0.06
300 0.06
301 0.05
302 0.06
303 0.07
304 0.07
305 0.07
306 0.06
307 0.1
308 0.13
309 0.16
310 0.2
311 0.26
312 0.31
313 0.39
314 0.48
315 0.56
316 0.62
317 0.7
318 0.75
319 0.8
320 0.85
321 0.89
322 0.9
323 0.9
324 0.91
325 0.89
326 0.83
327 0.73
328 0.69
329 0.63
330 0.63
331 0.6
332 0.55
333 0.49
334 0.44
335 0.43
336 0.37
337 0.38
338 0.33
339 0.29
340 0.27
341 0.33
342 0.41
343 0.44
344 0.48
345 0.5
346 0.47
347 0.51
348 0.52
349 0.5
350 0.48
351 0.46
352 0.5
353 0.46
354 0.54
355 0.53
356 0.55
357 0.54
358 0.53
359 0.54
360 0.53
361 0.52
362 0.46
363 0.41
364 0.36
365 0.37
366 0.37
367 0.37
368 0.33
369 0.3
370 0.29
371 0.27
372 0.26
373 0.22
374 0.2
375 0.2
376 0.22
377 0.32
378 0.38
379 0.43
380 0.49
381 0.57
382 0.58