Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J9SGU1

Protein Details
Accession A0A1J9SGU1    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
39-58EDIKREKKPKRANLTPAPPSHydrophilic
NLS Segment(s)
PositionSequence
43-49REKKPKR
Subcellular Location(s) nucl 14.5, cyto_nucl 11, mito 8, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MPSIHVIKSSAATMPKDKLSQPKETFSVFNDGDSDDLLEDIKREKKPKRANLTPAPPSSASSTTKRFESATKCN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.27
3 0.28
4 0.3
5 0.37
6 0.37
7 0.45
8 0.44
9 0.45
10 0.44
11 0.44
12 0.42
13 0.34
14 0.36
15 0.26
16 0.23
17 0.19
18 0.17
19 0.15
20 0.14
21 0.12
22 0.05
23 0.05
24 0.05
25 0.04
26 0.04
27 0.07
28 0.13
29 0.16
30 0.23
31 0.29
32 0.39
33 0.49
34 0.59
35 0.66
36 0.69
37 0.75
38 0.78
39 0.82
40 0.79
41 0.7
42 0.64
43 0.55
44 0.48
45 0.43
46 0.38
47 0.33
48 0.31
49 0.35
50 0.34
51 0.35
52 0.35
53 0.32
54 0.35