Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9RIV2

Protein Details
Accession A0A1J9RIV2   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
3-32KEKTTSRKTKASKADGKKKKDPNAPKRGLSBasic
NLS Segment(s)
PositionSequence
8-29SRKTKASKADGKKKKDPNAPKR
Subcellular Location(s) nucl 21, cyto_nucl 13.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKEKTTSRKTKASKADGKKKKDPNAPKRGLSAYMFFANDMRDKVREENPGIKFGEVGKILGEKWKALSEKQRAPYEAKAANDKKRYEDEKAAYAAGADEEDEASE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.79
3 0.83
4 0.83
5 0.85
6 0.85
7 0.84
8 0.83
9 0.83
10 0.84
11 0.84
12 0.85
13 0.83
14 0.76
15 0.71
16 0.64
17 0.57
18 0.48
19 0.39
20 0.31
21 0.27
22 0.24
23 0.2
24 0.18
25 0.16
26 0.15
27 0.14
28 0.13
29 0.12
30 0.14
31 0.17
32 0.21
33 0.24
34 0.25
35 0.32
36 0.32
37 0.34
38 0.32
39 0.29
40 0.25
41 0.2
42 0.21
43 0.14
44 0.12
45 0.09
46 0.09
47 0.1
48 0.13
49 0.13
50 0.09
51 0.1
52 0.15
53 0.15
54 0.18
55 0.27
56 0.31
57 0.38
58 0.45
59 0.48
60 0.46
61 0.49
62 0.49
63 0.47
64 0.43
65 0.38
66 0.41
67 0.43
68 0.5
69 0.52
70 0.5
71 0.48
72 0.53
73 0.56
74 0.53
75 0.55
76 0.5
77 0.48
78 0.49
79 0.44
80 0.35
81 0.31
82 0.24
83 0.16
84 0.12
85 0.08
86 0.06