Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8B8Z5

Protein Details
Accession G8B8Z5    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
3-32LPTHFSCKKITPIKKKKNIPLCKTKRQLTYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12.5, cyto_mito 8.5, nucl 7, cyto 3.5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR041752  Coa3  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0033617  P:mitochondrial cytochrome c oxidase assembly  
Amino Acid Sequences MLLPTHFSCKKITPIKKKKNIPLCKTKRQLTYIYTHTQASMHGTLRTLGKIVGAPKGHDRYRDPVTHQITPALYRVRQPFFWRNTIGLFVVGAIPLGVYLYTFQKMTDDDFGDIPIPPISDEELKKLQSEYEGKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.78
3 0.84
4 0.9
5 0.9
6 0.9
7 0.91
8 0.88
9 0.88
10 0.86
11 0.87
12 0.86
13 0.83
14 0.79
15 0.73
16 0.69
17 0.62
18 0.59
19 0.54
20 0.49
21 0.44
22 0.37
23 0.33
24 0.28
25 0.24
26 0.22
27 0.19
28 0.16
29 0.15
30 0.15
31 0.16
32 0.17
33 0.17
34 0.13
35 0.1
36 0.09
37 0.1
38 0.11
39 0.15
40 0.14
41 0.15
42 0.2
43 0.26
44 0.27
45 0.28
46 0.29
47 0.3
48 0.34
49 0.35
50 0.33
51 0.36
52 0.39
53 0.37
54 0.35
55 0.31
56 0.27
57 0.25
58 0.24
59 0.18
60 0.15
61 0.17
62 0.22
63 0.22
64 0.24
65 0.29
66 0.34
67 0.36
68 0.4
69 0.37
70 0.33
71 0.32
72 0.32
73 0.26
74 0.18
75 0.13
76 0.1
77 0.08
78 0.07
79 0.06
80 0.04
81 0.03
82 0.03
83 0.03
84 0.03
85 0.02
86 0.04
87 0.06
88 0.07
89 0.08
90 0.08
91 0.09
92 0.1
93 0.13
94 0.17
95 0.17
96 0.17
97 0.17
98 0.18
99 0.17
100 0.17
101 0.15
102 0.11
103 0.1
104 0.09
105 0.1
106 0.12
107 0.18
108 0.19
109 0.23
110 0.28
111 0.28
112 0.29
113 0.29
114 0.27
115 0.28