Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9QY49

Protein Details
Accession A0A1J9QY49    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
197-228ESEPMRVKEKTKRRRRHVRHAKSKHRYTELRIBasic
NLS Segment(s)
PositionSequence
203-221VKEKTKRRRRHVRHAKSKH
Subcellular Location(s) mito 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036164  L21-like_sf  
Amino Acid Sequences MLSRSIARLSVQGANALMPAARILPVRARPLSTVSNTLEPGNVPDELIRSGVHKTSEPARRPTEAASAPSASAPSSASAPLPSPSAEAPSQGTTPLSDSVKELLPLLQAQKPHYISAHIHARPYLLTAGDTLRLPFLMHGVQLGDVLRLNRATLLGSRDFTLRAPAPVKGTRERPGTIMNYLDDRLFVCRAVVVGVESEPMRVKEKTKRRRRHVRHAKSKHRYTELRITELTVRTTEEAEAANVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.17
4 0.13
5 0.08
6 0.08
7 0.06
8 0.08
9 0.08
10 0.1
11 0.17
12 0.22
13 0.28
14 0.3
15 0.31
16 0.31
17 0.35
18 0.39
19 0.35
20 0.36
21 0.32
22 0.34
23 0.33
24 0.31
25 0.27
26 0.22
27 0.21
28 0.18
29 0.15
30 0.12
31 0.11
32 0.12
33 0.12
34 0.13
35 0.11
36 0.1
37 0.12
38 0.14
39 0.15
40 0.14
41 0.16
42 0.24
43 0.33
44 0.36
45 0.41
46 0.43
47 0.44
48 0.45
49 0.44
50 0.43
51 0.36
52 0.34
53 0.3
54 0.26
55 0.24
56 0.23
57 0.21
58 0.13
59 0.11
60 0.1
61 0.07
62 0.08
63 0.08
64 0.08
65 0.08
66 0.09
67 0.1
68 0.1
69 0.09
70 0.1
71 0.09
72 0.13
73 0.12
74 0.12
75 0.13
76 0.14
77 0.14
78 0.13
79 0.13
80 0.09
81 0.11
82 0.13
83 0.12
84 0.1
85 0.11
86 0.12
87 0.13
88 0.13
89 0.11
90 0.09
91 0.09
92 0.1
93 0.11
94 0.11
95 0.12
96 0.14
97 0.18
98 0.19
99 0.19
100 0.18
101 0.18
102 0.17
103 0.21
104 0.28
105 0.23
106 0.23
107 0.22
108 0.22
109 0.2
110 0.2
111 0.15
112 0.07
113 0.06
114 0.07
115 0.07
116 0.08
117 0.08
118 0.07
119 0.06
120 0.06
121 0.06
122 0.06
123 0.06
124 0.06
125 0.05
126 0.05
127 0.06
128 0.06
129 0.06
130 0.06
131 0.05
132 0.06
133 0.06
134 0.07
135 0.07
136 0.07
137 0.06
138 0.07
139 0.07
140 0.08
141 0.12
142 0.12
143 0.13
144 0.14
145 0.14
146 0.15
147 0.14
148 0.17
149 0.14
150 0.16
151 0.17
152 0.17
153 0.22
154 0.25
155 0.3
156 0.3
157 0.34
158 0.37
159 0.4
160 0.4
161 0.37
162 0.38
163 0.36
164 0.33
165 0.3
166 0.25
167 0.22
168 0.22
169 0.2
170 0.15
171 0.13
172 0.14
173 0.12
174 0.11
175 0.09
176 0.09
177 0.09
178 0.09
179 0.09
180 0.06
181 0.06
182 0.07
183 0.08
184 0.08
185 0.09
186 0.1
187 0.12
188 0.15
189 0.16
190 0.22
191 0.3
192 0.41
193 0.51
194 0.6
195 0.7
196 0.77
197 0.86
198 0.91
199 0.93
200 0.93
201 0.94
202 0.94
203 0.95
204 0.95
205 0.94
206 0.94
207 0.91
208 0.89
209 0.83
210 0.79
211 0.79
212 0.73
213 0.67
214 0.59
215 0.53
216 0.5
217 0.47
218 0.41
219 0.31
220 0.28
221 0.24
222 0.25
223 0.22
224 0.18
225 0.16