Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8BG29

Protein Details
Accession G8BG29    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
6-36DNIEVKTEPEKQERRKRKKKLEIACVYCRRSHydrophilic
NLS Segment(s)
PositionSequence
16-25KQERRKRKKK
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0001228  F:DNA-binding transcription activator activity, RNA polymerase II-specific  
GO:0000978  F:RNA polymerase II cis-regulatory region sequence-specific DNA binding  
GO:0008270  F:zinc ion binding  
GO:0071466  P:cellular response to xenobiotic stimulus  
GO:0061415  P:negative regulation of transcription from RNA polymerase II promoter by a nonfermentable carbon source  
GO:0061414  P:positive regulation of transcription from RNA polymerase II promoter by a nonfermentable carbon source  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MEVTNDNIEVKTEPEKQERRKRKKKLEIACVYCRRSHMICDESRPCQRCIKRGIGHLCYDEPSNSRQRRKAAALRNTETPKEQSPAPAPTAQDSTPLPPPIQVNPGQQKTLKNSVLSQTLAYNQEPLFYSEHAGSEFSSLNDFLSIIDDPELVNGALNDDPNHAFWGNTMAFSPNNLFNQTFPEEIVQQPVAEENAPKSPRETQAPSSSETQAKDAQPVISDSARDKFFLTAADPTTEISPEERLKQVIKAKLEAGLLQPYNYAKGYARLQRYMDNYMNISSRQRILKPLSIFRPAFRAIARTLKDVDLVLVEESFERMLLDYDRVFTSMAIPACLWRRTGEIYRGNKEFASLVGVTTDDLKDGKLAIYELMSEESAVNFWEKYGAIAFDKGQKAVLTSCNLRTKDGIKRKSCCFSFTIRRDRYNIPSCIVGNFIPIDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.51
3 0.6
4 0.7
5 0.79
6 0.83
7 0.87
8 0.92
9 0.93
10 0.95
11 0.94
12 0.94
13 0.93
14 0.93
15 0.9
16 0.89
17 0.87
18 0.79
19 0.72
20 0.64
21 0.58
22 0.5
23 0.47
24 0.45
25 0.44
26 0.44
27 0.5
28 0.53
29 0.55
30 0.62
31 0.59
32 0.54
33 0.56
34 0.58
35 0.58
36 0.6
37 0.63
38 0.6
39 0.66
40 0.72
41 0.67
42 0.65
43 0.61
44 0.54
45 0.46
46 0.41
47 0.34
48 0.28
49 0.28
50 0.34
51 0.4
52 0.46
53 0.51
54 0.55
55 0.6
56 0.67
57 0.7
58 0.7
59 0.71
60 0.72
61 0.7
62 0.72
63 0.69
64 0.63
65 0.57
66 0.5
67 0.44
68 0.37
69 0.35
70 0.32
71 0.33
72 0.35
73 0.35
74 0.34
75 0.31
76 0.32
77 0.34
78 0.28
79 0.26
80 0.23
81 0.23
82 0.25
83 0.26
84 0.23
85 0.22
86 0.25
87 0.24
88 0.28
89 0.29
90 0.33
91 0.4
92 0.42
93 0.43
94 0.44
95 0.46
96 0.47
97 0.51
98 0.45
99 0.38
100 0.38
101 0.39
102 0.39
103 0.35
104 0.29
105 0.22
106 0.23
107 0.24
108 0.21
109 0.21
110 0.17
111 0.18
112 0.18
113 0.19
114 0.17
115 0.15
116 0.17
117 0.14
118 0.15
119 0.13
120 0.13
121 0.11
122 0.11
123 0.11
124 0.09
125 0.1
126 0.09
127 0.09
128 0.09
129 0.08
130 0.06
131 0.08
132 0.07
133 0.07
134 0.07
135 0.07
136 0.07
137 0.07
138 0.08
139 0.05
140 0.05
141 0.05
142 0.06
143 0.06
144 0.07
145 0.07
146 0.09
147 0.09
148 0.1
149 0.12
150 0.1
151 0.1
152 0.09
153 0.14
154 0.13
155 0.12
156 0.12
157 0.12
158 0.11
159 0.12
160 0.14
161 0.12
162 0.13
163 0.15
164 0.14
165 0.13
166 0.18
167 0.19
168 0.17
169 0.15
170 0.15
171 0.14
172 0.14
173 0.16
174 0.12
175 0.1
176 0.09
177 0.09
178 0.09
179 0.08
180 0.08
181 0.07
182 0.13
183 0.14
184 0.14
185 0.16
186 0.19
187 0.22
188 0.27
189 0.29
190 0.27
191 0.35
192 0.36
193 0.37
194 0.35
195 0.35
196 0.32
197 0.29
198 0.27
199 0.23
200 0.22
201 0.21
202 0.19
203 0.17
204 0.15
205 0.15
206 0.15
207 0.11
208 0.11
209 0.11
210 0.13
211 0.14
212 0.14
213 0.13
214 0.12
215 0.12
216 0.12
217 0.12
218 0.1
219 0.11
220 0.11
221 0.1
222 0.1
223 0.1
224 0.1
225 0.09
226 0.07
227 0.1
228 0.11
229 0.13
230 0.13
231 0.14
232 0.15
233 0.2
234 0.25
235 0.27
236 0.27
237 0.26
238 0.26
239 0.27
240 0.27
241 0.23
242 0.18
243 0.18
244 0.16
245 0.14
246 0.15
247 0.12
248 0.14
249 0.13
250 0.13
251 0.09
252 0.12
253 0.18
254 0.23
255 0.26
256 0.28
257 0.29
258 0.33
259 0.35
260 0.38
261 0.35
262 0.29
263 0.27
264 0.25
265 0.25
266 0.22
267 0.2
268 0.16
269 0.19
270 0.2
271 0.21
272 0.25
273 0.28
274 0.33
275 0.36
276 0.41
277 0.41
278 0.45
279 0.44
280 0.39
281 0.4
282 0.35
283 0.32
284 0.26
285 0.25
286 0.2
287 0.27
288 0.28
289 0.26
290 0.26
291 0.25
292 0.25
293 0.22
294 0.2
295 0.12
296 0.11
297 0.09
298 0.07
299 0.07
300 0.06
301 0.07
302 0.06
303 0.05
304 0.05
305 0.05
306 0.06
307 0.07
308 0.09
309 0.09
310 0.11
311 0.11
312 0.12
313 0.12
314 0.11
315 0.12
316 0.14
317 0.14
318 0.13
319 0.13
320 0.15
321 0.2
322 0.21
323 0.2
324 0.16
325 0.19
326 0.23
327 0.29
328 0.34
329 0.39
330 0.45
331 0.5
332 0.51
333 0.5
334 0.44
335 0.4
336 0.32
337 0.23
338 0.2
339 0.14
340 0.12
341 0.11
342 0.12
343 0.11
344 0.12
345 0.12
346 0.08
347 0.08
348 0.08
349 0.08
350 0.09
351 0.09
352 0.08
353 0.09
354 0.09
355 0.09
356 0.09
357 0.1
358 0.1
359 0.1
360 0.09
361 0.09
362 0.09
363 0.09
364 0.09
365 0.09
366 0.07
367 0.07
368 0.09
369 0.08
370 0.09
371 0.11
372 0.13
373 0.13
374 0.15
375 0.17
376 0.23
377 0.25
378 0.24
379 0.24
380 0.22
381 0.22
382 0.24
383 0.27
384 0.24
385 0.27
386 0.34
387 0.41
388 0.42
389 0.42
390 0.43
391 0.44
392 0.49
393 0.56
394 0.58
395 0.59
396 0.64
397 0.7
398 0.76
399 0.71
400 0.64
401 0.58
402 0.58
403 0.6
404 0.63
405 0.67
406 0.64
407 0.67
408 0.69
409 0.72
410 0.72
411 0.7
412 0.64
413 0.55
414 0.53
415 0.48
416 0.44
417 0.4
418 0.3
419 0.24