Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8B8M5

Protein Details
Accession G8B8M5   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
128-151QDSRYDRQKLKRLKDLQNMRSRLQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 15.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013251  DASH_Spc19  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0042729  C:DASH complex  
GO:0005876  C:spindle microtubule  
GO:0008608  P:attachment of spindle microtubules to kinetochore  
Pfam View protein in Pfam  
PF08287  DASH_Spc19  
Amino Acid Sequences MAQPPSYHPYNNLQNCNNSIKESIELLRNSNQKLKDATTDSARLKHILSTKKIFGLVPELDLDDAKQSYSETITPQVNKRFVKLKEETNRLELRSKELAQELNLAREKLKSYRSGREAWELNVEELSQDSRYDRQKLKRLKDLQNMRSRLQFNVNLMQT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.57
3 0.58
4 0.51
5 0.43
6 0.37
7 0.31
8 0.29
9 0.27
10 0.25
11 0.26
12 0.25
13 0.26
14 0.31
15 0.34
16 0.35
17 0.39
18 0.37
19 0.35
20 0.37
21 0.36
22 0.35
23 0.35
24 0.35
25 0.33
26 0.38
27 0.36
28 0.37
29 0.35
30 0.3
31 0.27
32 0.28
33 0.3
34 0.31
35 0.34
36 0.35
37 0.36
38 0.36
39 0.37
40 0.32
41 0.26
42 0.25
43 0.2
44 0.16
45 0.15
46 0.13
47 0.12
48 0.12
49 0.12
50 0.07
51 0.07
52 0.06
53 0.06
54 0.05
55 0.06
56 0.07
57 0.08
58 0.07
59 0.11
60 0.13
61 0.15
62 0.2
63 0.24
64 0.29
65 0.28
66 0.29
67 0.34
68 0.33
69 0.38
70 0.36
71 0.41
72 0.43
73 0.48
74 0.48
75 0.46
76 0.47
77 0.41
78 0.43
79 0.34
80 0.31
81 0.3
82 0.29
83 0.25
84 0.25
85 0.24
86 0.2
87 0.26
88 0.21
89 0.22
90 0.23
91 0.22
92 0.21
93 0.21
94 0.23
95 0.21
96 0.24
97 0.27
98 0.3
99 0.39
100 0.42
101 0.44
102 0.45
103 0.48
104 0.46
105 0.39
106 0.41
107 0.33
108 0.3
109 0.27
110 0.24
111 0.16
112 0.15
113 0.15
114 0.09
115 0.09
116 0.1
117 0.15
118 0.21
119 0.29
120 0.36
121 0.43
122 0.52
123 0.62
124 0.68
125 0.73
126 0.77
127 0.8
128 0.82
129 0.84
130 0.84
131 0.84
132 0.8
133 0.73
134 0.71
135 0.63
136 0.56
137 0.53
138 0.48
139 0.43