Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9RJT7

Protein Details
Accession A0A1J9RJT7   
Localization Confidence Low
Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
3-27TTTTTTKQRMLKKIRAKKNSWVMLSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18.5, cyto_mito 11.666, cyto_nucl 5.333, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR044852  WBP2-like  
Gene Ontology GO:0003713  F:transcription coactivator activity  
CDD cd13214  PH-GRAM_WBP2  
Amino Acid Sequences MATTTTTTKQRMLKKIRAKKNSWVMLSPSEGFTLLPGEQRLYTSPPRTALALQSLNKYPGKEPFNITSSAGCVHLTSRRIVYLPASPSDSLQSFAAPILNLHDTHVNAPFFGPNVWSAIVQPVPGGNIPSQHAALELKLTFKDGGAYDFSQGYERIKERMQQAIEVARESGNYHGSVDGSDNGSLRTGGPLAGVDLNTVHLEQLPAYEPPPPAGADVVIPDTSRDSGLGMNTPEGAPAPKPDDNYDPPSEPPPGYEEVQSQSVADELERRLRGPQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.8
3 0.84
4 0.87
5 0.83
6 0.83
7 0.84
8 0.82
9 0.75
10 0.68
11 0.62
12 0.56
13 0.55
14 0.46
15 0.36
16 0.28
17 0.25
18 0.2
19 0.16
20 0.15
21 0.12
22 0.13
23 0.13
24 0.14
25 0.14
26 0.16
27 0.17
28 0.2
29 0.27
30 0.28
31 0.3
32 0.31
33 0.32
34 0.32
35 0.32
36 0.29
37 0.29
38 0.32
39 0.31
40 0.33
41 0.34
42 0.36
43 0.36
44 0.35
45 0.3
46 0.31
47 0.33
48 0.32
49 0.35
50 0.35
51 0.36
52 0.36
53 0.34
54 0.27
55 0.24
56 0.22
57 0.18
58 0.13
59 0.11
60 0.11
61 0.15
62 0.15
63 0.16
64 0.16
65 0.17
66 0.17
67 0.17
68 0.18
69 0.19
70 0.2
71 0.2
72 0.21
73 0.2
74 0.2
75 0.22
76 0.2
77 0.16
78 0.14
79 0.12
80 0.1
81 0.1
82 0.1
83 0.07
84 0.07
85 0.08
86 0.09
87 0.09
88 0.1
89 0.12
90 0.11
91 0.13
92 0.17
93 0.14
94 0.13
95 0.13
96 0.12
97 0.11
98 0.1
99 0.1
100 0.06
101 0.08
102 0.08
103 0.08
104 0.08
105 0.09
106 0.09
107 0.08
108 0.08
109 0.07
110 0.07
111 0.07
112 0.08
113 0.06
114 0.07
115 0.09
116 0.1
117 0.1
118 0.09
119 0.09
120 0.09
121 0.08
122 0.09
123 0.08
124 0.07
125 0.07
126 0.08
127 0.08
128 0.07
129 0.09
130 0.07
131 0.09
132 0.1
133 0.11
134 0.11
135 0.11
136 0.11
137 0.1
138 0.11
139 0.1
140 0.12
141 0.12
142 0.14
143 0.14
144 0.18
145 0.2
146 0.25
147 0.25
148 0.22
149 0.23
150 0.24
151 0.24
152 0.2
153 0.18
154 0.12
155 0.12
156 0.12
157 0.12
158 0.09
159 0.09
160 0.09
161 0.09
162 0.09
163 0.09
164 0.1
165 0.09
166 0.09
167 0.1
168 0.09
169 0.09
170 0.09
171 0.09
172 0.08
173 0.08
174 0.07
175 0.06
176 0.06
177 0.06
178 0.07
179 0.08
180 0.07
181 0.07
182 0.06
183 0.08
184 0.08
185 0.08
186 0.07
187 0.06
188 0.06
189 0.06
190 0.07
191 0.08
192 0.08
193 0.09
194 0.13
195 0.13
196 0.14
197 0.15
198 0.14
199 0.13
200 0.13
201 0.13
202 0.09
203 0.1
204 0.11
205 0.1
206 0.1
207 0.09
208 0.11
209 0.11
210 0.11
211 0.1
212 0.09
213 0.1
214 0.11
215 0.14
216 0.13
217 0.13
218 0.14
219 0.14
220 0.13
221 0.12
222 0.13
223 0.11
224 0.13
225 0.19
226 0.21
227 0.23
228 0.27
229 0.34
230 0.38
231 0.43
232 0.45
233 0.41
234 0.4
235 0.42
236 0.41
237 0.34
238 0.3
239 0.27
240 0.26
241 0.26
242 0.26
243 0.25
244 0.26
245 0.28
246 0.26
247 0.22
248 0.18
249 0.17
250 0.15
251 0.13
252 0.13
253 0.14
254 0.22
255 0.23
256 0.24