Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J9RW13

Protein Details
Accession A0A1J9RW13    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
67-87HEDRRERRKEERKAAKRAKESBasic
116-140AKAWKEGRAERKKMRAERRRAGRCGBasic
NLS Segment(s)
PositionSequence
70-86RRERRKEERKAAKRAKE
115-137GAKAWKEGRAERKKMRAERRRAG
Subcellular Location(s) mito 15, nucl 6, cyto 5
Family & Domain DBs
Amino Acid Sequences MGVSQHLPAAAAAAASTTTAAAPPPSTVPAIFHPPEQPATDHQQHPCHDPSYVAALFAVWRAESAAHEDRRERRKEERKAAKRAKESEASDGARVADLRREEEERRQQLQEGGQGAKAWKEGRAERKKMRAERRRAGRCGGGVGDGVLGGEGEVGLGVGEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.06
4 0.04
5 0.04
6 0.05
7 0.06
8 0.06
9 0.07
10 0.08
11 0.1
12 0.12
13 0.13
14 0.13
15 0.15
16 0.17
17 0.24
18 0.23
19 0.23
20 0.24
21 0.25
22 0.27
23 0.26
24 0.24
25 0.21
26 0.28
27 0.33
28 0.35
29 0.37
30 0.41
31 0.41
32 0.44
33 0.43
34 0.36
35 0.3
36 0.26
37 0.23
38 0.23
39 0.21
40 0.17
41 0.13
42 0.12
43 0.12
44 0.12
45 0.11
46 0.04
47 0.04
48 0.05
49 0.05
50 0.05
51 0.11
52 0.17
53 0.19
54 0.2
55 0.24
56 0.31
57 0.39
58 0.42
59 0.4
60 0.44
61 0.53
62 0.61
63 0.68
64 0.71
65 0.72
66 0.79
67 0.84
68 0.81
69 0.77
70 0.72
71 0.66
72 0.61
73 0.54
74 0.47
75 0.44
76 0.37
77 0.31
78 0.27
79 0.22
80 0.17
81 0.15
82 0.11
83 0.1
84 0.1
85 0.12
86 0.13
87 0.17
88 0.19
89 0.27
90 0.37
91 0.39
92 0.42
93 0.41
94 0.4
95 0.39
96 0.39
97 0.35
98 0.28
99 0.23
100 0.2
101 0.2
102 0.19
103 0.17
104 0.18
105 0.14
106 0.14
107 0.18
108 0.24
109 0.34
110 0.44
111 0.52
112 0.57
113 0.65
114 0.72
115 0.76
116 0.81
117 0.8
118 0.8
119 0.82
120 0.85
121 0.85
122 0.8
123 0.75
124 0.69
125 0.61
126 0.54
127 0.45
128 0.35
129 0.26
130 0.23
131 0.17
132 0.12
133 0.1
134 0.06
135 0.05
136 0.04
137 0.03
138 0.03
139 0.03
140 0.02
141 0.03