Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9SF94

Protein Details
Accession A0A1J9SF94   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
80-105AALKARGKGAPKKKRGPPELKGKRKKBasic
NLS Segment(s)
PositionSequence
82-105LKARGKGAPKKKRGPPELKGKRKK
Subcellular Location(s) cyto 19, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MAVPRARIVDLMRVQCKVFNTVFNPEGHRLGTKVLRERLKGPSVAAYYPRRIGTFNDLVKLYPEWEGLDTYEWDRQEKVAALKARGKGAPKKKRGPPELKGKRKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.37
3 0.37
4 0.33
5 0.28
6 0.25
7 0.26
8 0.3
9 0.32
10 0.31
11 0.34
12 0.31
13 0.31
14 0.27
15 0.25
16 0.19
17 0.21
18 0.23
19 0.24
20 0.28
21 0.33
22 0.36
23 0.38
24 0.4
25 0.43
26 0.41
27 0.37
28 0.31
29 0.29
30 0.26
31 0.25
32 0.28
33 0.24
34 0.23
35 0.25
36 0.25
37 0.21
38 0.2
39 0.21
40 0.22
41 0.25
42 0.24
43 0.24
44 0.23
45 0.23
46 0.23
47 0.22
48 0.16
49 0.1
50 0.1
51 0.09
52 0.09
53 0.1
54 0.09
55 0.1
56 0.1
57 0.11
58 0.14
59 0.14
60 0.14
61 0.14
62 0.14
63 0.15
64 0.17
65 0.17
66 0.21
67 0.24
68 0.27
69 0.33
70 0.35
71 0.37
72 0.37
73 0.41
74 0.44
75 0.51
76 0.58
77 0.62
78 0.69
79 0.73
80 0.81
81 0.85
82 0.85
83 0.83
84 0.84
85 0.86