Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J9SFG8

Protein Details
Accession A0A1J9SFG8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
69-93APGPVSTKKRFLKLRRRVRTFTSNPHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 17, cysk 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR014752  Arrestin-like_C  
IPR039634  Bul1-like  
Amino Acid Sequences MASSADGLNVVDVAIHVNTAGSDGNHGGFASGDEITGEVVVTTPEDVHVRKVDVFFTGRSQTCIDSIIAPGPVSTKKRFLKLRRRVRTFTSNPDGSWPIPFSFLVPHALDPAACSCVSLPDDHLQLPPTMGGNHSWEHAGQLLDDPTPDMVDICYKIVARVEVSDSQGRCACTETHTKLCVVPSFPEPPPSFSSEYRIREEKGVRRSILTGRLGCLVMEAQTPSALKGIKSDGATLVSTKVLVRFDPASHDCAPPAPEDIMRKIQATSTWKIGPKGTSSNGQTTYAMTRAYTEAISLPPFHLAGAKWLKRSPGWEHMQVSNGHAAPADLIAPSSGYIGGVYYLLKLAIPVELPPGKVLVPTFHSCLVSRTYELEVALLLSSAASITVRVPLHICT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.06
5 0.06
6 0.07
7 0.08
8 0.06
9 0.09
10 0.1
11 0.11
12 0.11
13 0.11
14 0.1
15 0.09
16 0.1
17 0.09
18 0.08
19 0.07
20 0.07
21 0.07
22 0.07
23 0.07
24 0.06
25 0.04
26 0.04
27 0.04
28 0.05
29 0.05
30 0.05
31 0.07
32 0.1
33 0.11
34 0.15
35 0.18
36 0.2
37 0.22
38 0.23
39 0.23
40 0.23
41 0.25
42 0.22
43 0.24
44 0.28
45 0.26
46 0.27
47 0.28
48 0.25
49 0.24
50 0.24
51 0.21
52 0.15
53 0.16
54 0.15
55 0.15
56 0.13
57 0.13
58 0.13
59 0.18
60 0.22
61 0.24
62 0.31
63 0.35
64 0.43
65 0.53
66 0.61
67 0.67
68 0.72
69 0.8
70 0.82
71 0.86
72 0.82
73 0.8
74 0.81
75 0.75
76 0.74
77 0.72
78 0.62
79 0.54
80 0.54
81 0.49
82 0.39
83 0.36
84 0.28
85 0.2
86 0.2
87 0.2
88 0.16
89 0.16
90 0.16
91 0.17
92 0.16
93 0.16
94 0.15
95 0.16
96 0.14
97 0.13
98 0.13
99 0.11
100 0.1
101 0.1
102 0.08
103 0.11
104 0.12
105 0.12
106 0.13
107 0.14
108 0.16
109 0.17
110 0.18
111 0.16
112 0.15
113 0.15
114 0.13
115 0.1
116 0.09
117 0.09
118 0.1
119 0.11
120 0.12
121 0.12
122 0.12
123 0.11
124 0.11
125 0.12
126 0.11
127 0.08
128 0.09
129 0.1
130 0.09
131 0.09
132 0.09
133 0.07
134 0.07
135 0.07
136 0.05
137 0.04
138 0.06
139 0.07
140 0.07
141 0.08
142 0.08
143 0.09
144 0.09
145 0.1
146 0.09
147 0.09
148 0.11
149 0.12
150 0.15
151 0.18
152 0.18
153 0.19
154 0.21
155 0.2
156 0.18
157 0.17
158 0.15
159 0.14
160 0.22
161 0.24
162 0.26
163 0.26
164 0.27
165 0.26
166 0.27
167 0.26
168 0.2
169 0.18
170 0.17
171 0.21
172 0.2
173 0.26
174 0.24
175 0.26
176 0.27
177 0.29
178 0.29
179 0.25
180 0.31
181 0.31
182 0.34
183 0.34
184 0.34
185 0.3
186 0.32
187 0.37
188 0.38
189 0.38
190 0.39
191 0.36
192 0.35
193 0.37
194 0.35
195 0.35
196 0.32
197 0.25
198 0.22
199 0.23
200 0.22
201 0.19
202 0.17
203 0.11
204 0.08
205 0.08
206 0.07
207 0.06
208 0.06
209 0.07
210 0.07
211 0.08
212 0.08
213 0.08
214 0.09
215 0.11
216 0.13
217 0.13
218 0.14
219 0.13
220 0.14
221 0.14
222 0.13
223 0.12
224 0.09
225 0.09
226 0.08
227 0.1
228 0.09
229 0.09
230 0.11
231 0.11
232 0.12
233 0.18
234 0.19
235 0.22
236 0.23
237 0.24
238 0.21
239 0.22
240 0.22
241 0.16
242 0.17
243 0.13
244 0.14
245 0.16
246 0.2
247 0.23
248 0.23
249 0.23
250 0.21
251 0.21
252 0.24
253 0.26
254 0.25
255 0.25
256 0.28
257 0.3
258 0.31
259 0.33
260 0.3
261 0.28
262 0.31
263 0.29
264 0.31
265 0.31
266 0.35
267 0.34
268 0.34
269 0.3
270 0.27
271 0.27
272 0.22
273 0.19
274 0.14
275 0.13
276 0.13
277 0.14
278 0.12
279 0.1
280 0.1
281 0.11
282 0.13
283 0.12
284 0.11
285 0.11
286 0.11
287 0.11
288 0.11
289 0.1
290 0.17
291 0.26
292 0.29
293 0.31
294 0.33
295 0.36
296 0.35
297 0.4
298 0.39
299 0.39
300 0.42
301 0.45
302 0.47
303 0.46
304 0.49
305 0.44
306 0.4
307 0.36
308 0.3
309 0.23
310 0.2
311 0.17
312 0.14
313 0.13
314 0.11
315 0.06
316 0.06
317 0.05
318 0.06
319 0.06
320 0.06
321 0.06
322 0.05
323 0.05
324 0.05
325 0.06
326 0.06
327 0.06
328 0.06
329 0.06
330 0.06
331 0.06
332 0.06
333 0.06
334 0.07
335 0.07
336 0.07
337 0.14
338 0.16
339 0.16
340 0.17
341 0.18
342 0.16
343 0.18
344 0.18
345 0.15
346 0.2
347 0.23
348 0.25
349 0.27
350 0.29
351 0.27
352 0.29
353 0.3
354 0.27
355 0.25
356 0.25
357 0.25
358 0.24
359 0.24
360 0.21
361 0.17
362 0.14
363 0.13
364 0.1
365 0.07
366 0.05
367 0.05
368 0.05
369 0.05
370 0.04
371 0.05
372 0.05
373 0.12
374 0.12
375 0.14