Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8B5N0

Protein Details
Accession G8B5N0    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MRPTLALRVRPRRPERPNQTPLLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito 9, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008381  SDHAF3/Sdh7  
Gene Ontology GO:0005758  C:mitochondrial intermembrane space  
GO:0005759  C:mitochondrial matrix  
GO:0015976  P:carbon utilization  
GO:0034553  P:mitochondrial respiratory chain complex II assembly  
GO:0006111  P:regulation of gluconeogenesis  
Pfam View protein in Pfam  
PF13233  Complex1_LYR_2  
CDD cd20270  Complex1_LYR_SDHAF3_LYRM10  
Amino Acid Sequences MRPTLALRVRPRRPERPNQTPLLPPLKLYRAILRAHVHKLPQELRYLGDEYVKKEFKDHKKIDNPLHIVGFLTEWQDYLKQVDGGKWLDGKLSKTELDKMTPEQVGQLYELMKATKKIGEDEVSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.84
3 0.84
4 0.83
5 0.78
6 0.74
7 0.68
8 0.65
9 0.61
10 0.51
11 0.42
12 0.4
13 0.38
14 0.36
15 0.33
16 0.32
17 0.3
18 0.31
19 0.35
20 0.35
21 0.35
22 0.37
23 0.38
24 0.34
25 0.32
26 0.37
27 0.35
28 0.32
29 0.3
30 0.27
31 0.25
32 0.26
33 0.25
34 0.2
35 0.21
36 0.2
37 0.19
38 0.25
39 0.26
40 0.23
41 0.25
42 0.34
43 0.38
44 0.48
45 0.49
46 0.51
47 0.57
48 0.64
49 0.65
50 0.63
51 0.57
52 0.48
53 0.44
54 0.35
55 0.27
56 0.21
57 0.16
58 0.09
59 0.08
60 0.06
61 0.06
62 0.06
63 0.07
64 0.07
65 0.08
66 0.09
67 0.1
68 0.1
69 0.11
70 0.15
71 0.15
72 0.16
73 0.16
74 0.15
75 0.16
76 0.17
77 0.18
78 0.18
79 0.19
80 0.2
81 0.21
82 0.27
83 0.26
84 0.27
85 0.28
86 0.28
87 0.29
88 0.28
89 0.26
90 0.23
91 0.22
92 0.2
93 0.18
94 0.17
95 0.13
96 0.13
97 0.14
98 0.13
99 0.14
100 0.15
101 0.16
102 0.17
103 0.18
104 0.21
105 0.25