Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J9RY57

Protein Details
Accession A0A1J9RY57    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
20-43ASSARIKKSKKNSQTKFKVRCHRYHydrophilic
NLS Segment(s)
PositionSequence
24-30RIKKSKK
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPSEVSDIKQFIEICRRKDASSARIKKSKKNSQTKFKVRCHRYLYTLVLKDSDKAEKLKQSLPPGLTITDVPKKNAKGKHTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.41
3 0.43
4 0.39
5 0.45
6 0.48
7 0.47
8 0.53
9 0.58
10 0.57
11 0.63
12 0.65
13 0.67
14 0.71
15 0.72
16 0.71
17 0.74
18 0.75
19 0.78
20 0.86
21 0.88
22 0.87
23 0.86
24 0.86
25 0.79
26 0.78
27 0.74
28 0.66
29 0.6
30 0.54
31 0.5
32 0.47
33 0.44
34 0.36
35 0.32
36 0.29
37 0.26
38 0.24
39 0.22
40 0.17
41 0.18
42 0.21
43 0.24
44 0.27
45 0.31
46 0.34
47 0.37
48 0.41
49 0.39
50 0.39
51 0.35
52 0.32
53 0.29
54 0.25
55 0.25
56 0.28
57 0.28
58 0.29
59 0.34
60 0.38
61 0.45
62 0.5