Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8BH37

Protein Details
Accession G8BH37   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
194-215GTYQNTKLKKLQKQQRLAESEKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito 9, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007248  Mpv17_PMP22  
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAAVTFQSLNAQYLAYLMQYPLLTKSATSGVFNGLNETVSSIITNEYKETKICGIKVKHVFSAKLLKMIIYGALIATPISHNMYAVINKIYKPPLTKKQKILQLLTSLSTVTPTISACFVSWISIINNYQRTSCNPIAELRKILFIVKAGLKKGYLPVLKSSLTTSFFALLVAQNFIRPELWVVFFNLVYFCLGTYQNTKLKKLQKQQRLAESEKLKEMEEKEKKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.09
3 0.09
4 0.07
5 0.1
6 0.1
7 0.11
8 0.12
9 0.13
10 0.13
11 0.12
12 0.14
13 0.16
14 0.17
15 0.17
16 0.16
17 0.18
18 0.21
19 0.21
20 0.21
21 0.16
22 0.16
23 0.14
24 0.14
25 0.11
26 0.09
27 0.09
28 0.07
29 0.09
30 0.1
31 0.11
32 0.12
33 0.14
34 0.15
35 0.15
36 0.17
37 0.2
38 0.23
39 0.24
40 0.31
41 0.31
42 0.39
43 0.46
44 0.46
45 0.46
46 0.46
47 0.44
48 0.4
49 0.47
50 0.38
51 0.34
52 0.32
53 0.26
54 0.23
55 0.23
56 0.19
57 0.1
58 0.09
59 0.05
60 0.05
61 0.05
62 0.04
63 0.04
64 0.04
65 0.05
66 0.06
67 0.06
68 0.06
69 0.07
70 0.09
71 0.09
72 0.1
73 0.12
74 0.11
75 0.12
76 0.15
77 0.16
78 0.16
79 0.2
80 0.26
81 0.34
82 0.43
83 0.49
84 0.53
85 0.58
86 0.63
87 0.63
88 0.59
89 0.51
90 0.45
91 0.39
92 0.33
93 0.26
94 0.2
95 0.15
96 0.13
97 0.1
98 0.06
99 0.06
100 0.05
101 0.05
102 0.06
103 0.06
104 0.05
105 0.07
106 0.07
107 0.07
108 0.06
109 0.07
110 0.07
111 0.09
112 0.1
113 0.12
114 0.16
115 0.16
116 0.17
117 0.17
118 0.2
119 0.25
120 0.27
121 0.24
122 0.22
123 0.26
124 0.3
125 0.31
126 0.3
127 0.23
128 0.22
129 0.21
130 0.21
131 0.16
132 0.12
133 0.13
134 0.15
135 0.17
136 0.17
137 0.18
138 0.17
139 0.18
140 0.19
141 0.23
142 0.21
143 0.2
144 0.22
145 0.25
146 0.25
147 0.25
148 0.25
149 0.21
150 0.22
151 0.21
152 0.19
153 0.17
154 0.16
155 0.15
156 0.14
157 0.12
158 0.1
159 0.11
160 0.1
161 0.1
162 0.11
163 0.11
164 0.11
165 0.1
166 0.11
167 0.12
168 0.14
169 0.14
170 0.15
171 0.16
172 0.16
173 0.16
174 0.14
175 0.12
176 0.1
177 0.09
178 0.08
179 0.09
180 0.09
181 0.11
182 0.15
183 0.21
184 0.26
185 0.3
186 0.33
187 0.39
188 0.48
189 0.55
190 0.62
191 0.66
192 0.7
193 0.77
194 0.82
195 0.84
196 0.82
197 0.77
198 0.75
199 0.72
200 0.65
201 0.61
202 0.54
203 0.45
204 0.43
205 0.43
206 0.45