Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8BGW3

Protein Details
Accession G8BGW3   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
204-223KPSVAASKPRPKPAPKQQDEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, cyto_nucl 10, mito 9, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR005061  Ist1  
IPR042277  IST1-like  
Gene Ontology GO:0005768  C:endosome  
GO:0032511  P:late endosome to vacuole transport via multivesicular body sorting pathway  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF03398  Ist1  
Amino Acid Sequences MAISKLKFTQEKKVALTKQQRRQLAELLKTGKESSAKIRVENIIRDDIYIELLELLELYCELLLARLNMILDRPACDPSLLEAVSSLIYAAHSTDLKEIVAIRDILIYKYGAEFGKEALENKEGHVPEKIVRRCGVEPPSEDLVNMYLVEIALAYSVPYSGLEHLKLDEEGEGDKEGGDEDDDGEGGTKERVEKETPLAELADKPSVAASKPRPKPAPKQQDEFDALAARFAALKNTPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.63
3 0.71
4 0.7
5 0.72
6 0.74
7 0.75
8 0.71
9 0.7
10 0.69
11 0.66
12 0.61
13 0.59
14 0.55
15 0.5
16 0.46
17 0.42
18 0.36
19 0.3
20 0.27
21 0.28
22 0.33
23 0.33
24 0.33
25 0.36
26 0.39
27 0.41
28 0.43
29 0.4
30 0.35
31 0.34
32 0.33
33 0.29
34 0.24
35 0.2
36 0.16
37 0.12
38 0.07
39 0.07
40 0.06
41 0.05
42 0.05
43 0.04
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.04
50 0.05
51 0.05
52 0.05
53 0.06
54 0.06
55 0.07
56 0.07
57 0.09
58 0.09
59 0.1
60 0.12
61 0.12
62 0.13
63 0.13
64 0.12
65 0.12
66 0.15
67 0.13
68 0.12
69 0.1
70 0.1
71 0.1
72 0.1
73 0.08
74 0.04
75 0.04
76 0.04
77 0.04
78 0.05
79 0.05
80 0.06
81 0.07
82 0.07
83 0.07
84 0.08
85 0.08
86 0.07
87 0.08
88 0.08
89 0.07
90 0.08
91 0.09
92 0.09
93 0.09
94 0.08
95 0.07
96 0.07
97 0.09
98 0.07
99 0.08
100 0.08
101 0.07
102 0.09
103 0.09
104 0.1
105 0.1
106 0.12
107 0.12
108 0.12
109 0.17
110 0.15
111 0.16
112 0.16
113 0.15
114 0.16
115 0.25
116 0.26
117 0.24
118 0.25
119 0.27
120 0.28
121 0.32
122 0.33
123 0.27
124 0.27
125 0.3
126 0.31
127 0.28
128 0.26
129 0.21
130 0.17
131 0.14
132 0.12
133 0.07
134 0.05
135 0.05
136 0.05
137 0.04
138 0.03
139 0.03
140 0.03
141 0.03
142 0.03
143 0.03
144 0.03
145 0.04
146 0.04
147 0.07
148 0.08
149 0.09
150 0.1
151 0.1
152 0.11
153 0.11
154 0.11
155 0.09
156 0.08
157 0.08
158 0.09
159 0.09
160 0.08
161 0.07
162 0.07
163 0.07
164 0.06
165 0.06
166 0.05
167 0.06
168 0.06
169 0.06
170 0.06
171 0.06
172 0.06
173 0.06
174 0.07
175 0.07
176 0.09
177 0.11
178 0.15
179 0.17
180 0.19
181 0.23
182 0.26
183 0.26
184 0.25
185 0.24
186 0.22
187 0.21
188 0.22
189 0.19
190 0.16
191 0.15
192 0.15
193 0.16
194 0.16
195 0.22
196 0.29
197 0.36
198 0.44
199 0.53
200 0.6
201 0.65
202 0.75
203 0.78
204 0.8
205 0.77
206 0.78
207 0.72
208 0.72
209 0.7
210 0.6
211 0.52
212 0.45
213 0.37
214 0.31
215 0.27
216 0.19
217 0.16
218 0.15
219 0.17