Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8BIJ5

Protein Details
Accession G8BIJ5    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MSAPGEKRKVSRKKKDPDAPKRSLSBasic
NLS Segment(s)
PositionSequence
6-21EKRKVSRKKKDPDAPK
Subcellular Location(s) nucl 24.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MSAPGEKRKVSRKKKDPDAPKRSLSAYMFFANENRDIVRAENPGISFGQVGKALGDKWKALSAEDKVPYENKAEADKKRYEKEKAEYAKKNSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.91
3 0.91
4 0.92
5 0.9
6 0.86
7 0.79
8 0.71
9 0.62
10 0.58
11 0.48
12 0.4
13 0.34
14 0.29
15 0.26
16 0.23
17 0.22
18 0.19
19 0.18
20 0.15
21 0.12
22 0.11
23 0.11
24 0.12
25 0.14
26 0.13
27 0.13
28 0.14
29 0.13
30 0.14
31 0.13
32 0.12
33 0.09
34 0.08
35 0.09
36 0.07
37 0.07
38 0.06
39 0.07
40 0.07
41 0.09
42 0.11
43 0.09
44 0.1
45 0.13
46 0.13
47 0.14
48 0.17
49 0.18
50 0.23
51 0.26
52 0.25
53 0.24
54 0.25
55 0.25
56 0.24
57 0.23
58 0.18
59 0.23
60 0.29
61 0.33
62 0.39
63 0.46
64 0.5
65 0.56
66 0.62
67 0.61
68 0.63
69 0.64
70 0.68
71 0.7
72 0.73
73 0.74