Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8B4R6

Protein Details
Accession G8B4R6    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
17-44KASADTEKSKRKEKREKRKNYSPLINNHHydrophilic
NLS Segment(s)
PositionSequence
22-35TEKSKRKEKREKRK
Subcellular Location(s) nucl 16, cyto_nucl 10, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR006721  ATP_synth_F1_esu_mt  
IPR036742  ATP_synth_F1_esu_sf_mt  
Gene Ontology GO:0000275  C:mitochondrial proton-transporting ATP synthase complex, catalytic sector F(1)  
GO:0046933  F:proton-transporting ATP synthase activity, rotational mechanism  
Pfam View protein in Pfam  
PF04627  ATP-synt_Eps  
CDD cd12153  F1-ATPase_epsilon  
Amino Acid Sequences MSTICKPIRKISFNKNKASADTEKSKRKEKREKRKNYSPLINNHHKHLFTTMSAYKQAGISLNKAFAIAAQTLRNSLKPEFKAAAERRGVVEAKVAVYENGKAGEPRELKPIDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.75
3 0.68
4 0.63
5 0.62
6 0.56
7 0.52
8 0.54
9 0.54
10 0.56
11 0.58
12 0.65
13 0.66
14 0.72
15 0.76
16 0.78
17 0.81
18 0.83
19 0.9
20 0.9
21 0.93
22 0.91
23 0.88
24 0.87
25 0.82
26 0.8
27 0.77
28 0.77
29 0.68
30 0.63
31 0.58
32 0.49
33 0.42
34 0.36
35 0.29
36 0.19
37 0.23
38 0.2
39 0.18
40 0.19
41 0.18
42 0.16
43 0.14
44 0.14
45 0.13
46 0.12
47 0.13
48 0.12
49 0.13
50 0.12
51 0.12
52 0.11
53 0.08
54 0.09
55 0.08
56 0.09
57 0.09
58 0.1
59 0.12
60 0.13
61 0.14
62 0.15
63 0.17
64 0.22
65 0.22
66 0.27
67 0.27
68 0.27
69 0.35
70 0.35
71 0.4
72 0.35
73 0.35
74 0.32
75 0.34
76 0.33
77 0.24
78 0.24
79 0.18
80 0.16
81 0.16
82 0.15
83 0.13
84 0.13
85 0.14
86 0.12
87 0.13
88 0.13
89 0.13
90 0.14
91 0.22
92 0.24
93 0.25
94 0.31