Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8BC77

Protein Details
Accession G8BC77    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
36-68FIEPGTPQKKEKKLRRREKRLKKQIIRDVNTLKBasic
275-298LIKETQSTKRRNLKIKNLRDRVSEHydrophilic
NLS Segment(s)
PositionSequence
42-58PQKKEKKLRRREKRLKK
Subcellular Location(s) nucl 14.5, mito 12, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR000589  Ribosomal_S15  
IPR005290  Ribosomal_S15_bac-type  
IPR009068  S15_NS1_RNA-bd  
Gene Ontology GO:0005763  C:mitochondrial small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00312  Ribosomal_S15  
Amino Acid Sequences MFKLPTRWLSVGRPLLSQAISSKSTSLGPKLAAKQFIEPGTPQKKEKKLRRREKRLKKQIIRDVNTLKQYDAKNVPFQVDPVLGDPKCQFFTRIMQKVEDQDSNLAYNVDRAEMEKLLYAAEKLSLENVSNNEEIRREIQQVEENKRKSVLTILNLRNTNNNDKKKLAIKYAREELQREPGDTASPEVQAAIMTVKIHFGMRHVKENKNDHATTTAVRELVQYRQKILRYLKRQDPKKYYYAIAKLGLTDDVITAEFNMGRKYLQEYKVWGDKILIKETQSTKRRNLKIKNLRDRVSEYHDLAKKNYEIMQKENLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.4
3 0.36
4 0.32
5 0.26
6 0.23
7 0.23
8 0.23
9 0.22
10 0.2
11 0.24
12 0.25
13 0.26
14 0.24
15 0.25
16 0.31
17 0.37
18 0.41
19 0.42
20 0.4
21 0.41
22 0.43
23 0.41
24 0.37
25 0.32
26 0.37
27 0.4
28 0.43
29 0.45
30 0.49
31 0.57
32 0.65
33 0.74
34 0.75
35 0.78
36 0.85
37 0.9
38 0.93
39 0.94
40 0.95
41 0.96
42 0.97
43 0.97
44 0.95
45 0.94
46 0.92
47 0.92
48 0.86
49 0.82
50 0.77
51 0.72
52 0.68
53 0.59
54 0.49
55 0.44
56 0.4
57 0.39
58 0.39
59 0.36
60 0.36
61 0.37
62 0.38
63 0.32
64 0.32
65 0.27
66 0.21
67 0.18
68 0.15
69 0.21
70 0.18
71 0.2
72 0.21
73 0.21
74 0.22
75 0.22
76 0.21
77 0.17
78 0.26
79 0.34
80 0.4
81 0.39
82 0.38
83 0.4
84 0.43
85 0.45
86 0.37
87 0.28
88 0.23
89 0.22
90 0.21
91 0.19
92 0.15
93 0.1
94 0.11
95 0.1
96 0.09
97 0.08
98 0.08
99 0.1
100 0.1
101 0.1
102 0.09
103 0.09
104 0.08
105 0.08
106 0.08
107 0.06
108 0.07
109 0.07
110 0.06
111 0.07
112 0.07
113 0.08
114 0.09
115 0.1
116 0.12
117 0.12
118 0.12
119 0.12
120 0.12
121 0.13
122 0.13
123 0.14
124 0.13
125 0.13
126 0.15
127 0.19
128 0.25
129 0.32
130 0.37
131 0.37
132 0.35
133 0.36
134 0.34
135 0.29
136 0.28
137 0.24
138 0.21
139 0.29
140 0.31
141 0.36
142 0.37
143 0.37
144 0.35
145 0.34
146 0.4
147 0.39
148 0.41
149 0.39
150 0.38
151 0.41
152 0.44
153 0.43
154 0.42
155 0.41
156 0.41
157 0.44
158 0.48
159 0.49
160 0.44
161 0.44
162 0.37
163 0.39
164 0.35
165 0.3
166 0.26
167 0.22
168 0.21
169 0.19
170 0.19
171 0.11
172 0.1
173 0.09
174 0.08
175 0.08
176 0.07
177 0.07
178 0.05
179 0.05
180 0.05
181 0.05
182 0.05
183 0.06
184 0.07
185 0.06
186 0.09
187 0.17
188 0.2
189 0.29
190 0.34
191 0.39
192 0.45
193 0.52
194 0.56
195 0.54
196 0.52
197 0.43
198 0.41
199 0.37
200 0.3
201 0.27
202 0.22
203 0.15
204 0.15
205 0.16
206 0.15
207 0.21
208 0.26
209 0.24
210 0.26
211 0.31
212 0.32
213 0.37
214 0.44
215 0.47
216 0.5
217 0.57
218 0.63
219 0.68
220 0.75
221 0.78
222 0.78
223 0.74
224 0.71
225 0.66
226 0.6
227 0.59
228 0.55
229 0.49
230 0.43
231 0.37
232 0.32
233 0.29
234 0.25
235 0.18
236 0.13
237 0.09
238 0.08
239 0.07
240 0.07
241 0.06
242 0.07
243 0.08
244 0.09
245 0.1
246 0.09
247 0.09
248 0.1
249 0.17
250 0.24
251 0.27
252 0.29
253 0.32
254 0.38
255 0.45
256 0.44
257 0.38
258 0.33
259 0.35
260 0.36
261 0.37
262 0.33
263 0.27
264 0.34
265 0.4
266 0.47
267 0.5
268 0.51
269 0.56
270 0.65
271 0.72
272 0.75
273 0.78
274 0.8
275 0.83
276 0.88
277 0.89
278 0.88
279 0.83
280 0.78
281 0.75
282 0.7
283 0.67
284 0.62
285 0.54
286 0.55
287 0.55
288 0.52
289 0.48
290 0.48
291 0.41
292 0.38
293 0.41
294 0.39
295 0.38
296 0.41