Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8BDE4

Protein Details
Accession G8BDE4    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MAKSKNHTNHNQNKKAHKNGIKKPKTYHydrophilic
NLS Segment(s)
PositionSequence
14-33KKAHKNGIKKPKTYKYPSLK
Subcellular Location(s) nucl 17, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQNKKAHKNGIKKPKTYKYPSLKGVDAKFRRNHRYALHGTAKALAKARAEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.82
3 0.81
4 0.8
5 0.79
6 0.8
7 0.84
8 0.81
9 0.77
10 0.78
11 0.77
12 0.76
13 0.73
14 0.73
15 0.71
16 0.71
17 0.7
18 0.65
19 0.58
20 0.54
21 0.51
22 0.51
23 0.46
24 0.46
25 0.47
26 0.51
27 0.56
28 0.54
29 0.56
30 0.49
31 0.54
32 0.52
33 0.54
34 0.53
35 0.47
36 0.45
37 0.46
38 0.45
39 0.39
40 0.37
41 0.32