FuNGI

G8B8I3

Protein Details

Accession

G8B8I3

Localization Confidence

High

Confidence Score

18.8

NoLS Segment(s)

Position	Sequence	Protein Nature
686-711	QLIVLRKSNKSSKKKSNQPVQEDEPS	Hydrophilic
717-744	ADKILIDPKKHEKKKKRSFDPYSRDAAG	Basic

NLS Segment(s)

Position	Sequence
724-771	PKKHEKKKKRSFDPYSRDAAGPKPVKRKKVMAEGKTSTYKLKQSRLKK

Subcellular Location(s)

nucl 22, cyto 3

Family & Domain DBs

InterPro	View protein in InterPro IPR002562 3'-5'_exonuclease_dom IPR012588 Exosome-assoc_fac_Rrp6_N IPR010997 HRDC-like_sf IPR002121 HRDC_dom IPR044876 HRDC_dom_sf IPR012337 RNaseH-like_sf IPR036397 RNaseH_sf IPR045092 Rrp6-like
Gene Ontology	GO:0000176 C:nuclear exosome (RNase complex) GO:0005730 C:nucleolus GO:0000175 F:3'-5'-RNA exonuclease activity GO:0000166 F:nucleotide binding GO:0042134 F:rRNA primary transcript binding GO:0000467 P:exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) GO:0071044 P:histone mRNA catabolic process GO:0071028 P:nuclear mRNA surveillance GO:0071040 P:nuclear polyadenylation-dependent antisense transcript catabolic process GO:0071039 P:nuclear polyadenylation-dependent CUT catabolic process GO:0071042 P:nuclear polyadenylation-dependent mRNA catabolic process GO:0071035 P:nuclear polyadenylation-dependent rRNA catabolic process GO:0071036 P:nuclear polyadenylation-dependent snoRNA catabolic process GO:0071037 P:nuclear polyadenylation-dependent snRNA catabolic process GO:0071038 P:nuclear polyadenylation-dependent tRNA catabolic process GO:0071051 P:polyadenylation-dependent snoRNA 3'-end processing GO:0000973 P:post-transcriptional tethering of RNA polymerase II gene DNA at nuclear periphery GO:0034473 P:U1 snRNA 3'-end processing GO:0034475 P:U4 snRNA 3'-end processing GO:0034476 P:U5 snRNA 3'-end processing
Pfam	View protein in Pfam PF01612 DNA_pol_A_exo1 PF00570 HRDC PF08066 PMC2NT
PROSITE	View protein in PROSITE PS50967 HRDC
CDD	cd06147 Rrp6p_like_exo

Amino Acid Sequences

MSTEDQDLFKNVLPNLMGTIRAATALAAQDVNFYKSVDPNISEEIDKRGRNLLTITNDLLRTASSQTNPVDPIRFGQENISSESSWNPVSNVIDSIFEKIDYTFDQINRKQTGGGEQKQYLEDGNSLISNDQAQRVEKPQSKFKVSVDNSEQEPFKPKITGKPNALQPWESVNKLTNPAPVYEDSIEVVDPPFYAHPYEYEIDTQPYPKSILSKSDPVPPKDWSSTSAIWVDTTEGLNKMIDELQQSTEIAVDLEHHDYRSYYGIVCLMQISNREKDWIIDTLVLRDDLSVLNKVFTDPKIIKVLHGAFMDIIWLQRDLGLYIVSLFDTYHASRQLGFSKFSLQYLLDTFAHFRTSKKYQLADWRIRPLPKPMLAYARSDTHFLLYIFDQLRNKLIDSDKLAQVLFDSRQVAKRRFEYTKFRPLSNNLGSKVSCPVMAANPKEPWGSLMYQYNVPAFKRPVVEQLYKWRDLIARKEDESVRYIMPNQLLVSLATLESPVDVGKVLNVPSYVSEHVRLNARELAKLIDDTLKESEQNDWAIVDKWSNQLTVEAEEPKVDIESVNGLLEKLLLNMSVLFSDGSLLNNNSSVVVPGVNGVRKQTYEFTDTGIEKHDFDKECGQRFEFVWKKLCEIDGVASISGKELEDASEEEEVGEPSETPNVSSSGEKSKTGQQVLFSKDEDIDPEQLIVLRKSNKSSKKKSNQPVQEDEPSIDYANADKILIDPKKHEKKKKRSFDPYSRDAAGPKPVKRKKVMAEGKTSTYKLKQSRLKK

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.22
2	0.24
3	0.22
4	0.2
5	0.16
6	0.17
7	0.13
8	0.13
9	0.13
10	0.09
11	0.11
12	0.11
13	0.12
14	0.11
15	0.1
16	0.15
17	0.17
18	0.19
19	0.17
20	0.17
21	0.18
22	0.2
23	0.25
24	0.24
25	0.24
26	0.25
27	0.28
28	0.29
29	0.29
30	0.27
31	0.31
32	0.34
33	0.33
34	0.32
35	0.35
36	0.33
37	0.34
38	0.35
39	0.35
40	0.33
41	0.36
42	0.37
43	0.34
44	0.34
45	0.32
46	0.29
47	0.22
48	0.18
49	0.19
50	0.21
51	0.18
52	0.23
53	0.25
54	0.28
55	0.3
56	0.31
57	0.3
58	0.26
59	0.28
60	0.3
61	0.29
62	0.26
63	0.28
64	0.31
65	0.3
66	0.34
67	0.34
68	0.27
69	0.27
70	0.28
71	0.26
72	0.22
73	0.2
74	0.16
75	0.16
76	0.18
77	0.18
78	0.18
79	0.16
80	0.17
81	0.18
82	0.2
83	0.17
84	0.16
85	0.15
86	0.13
87	0.15
88	0.13
89	0.17
90	0.19
91	0.22
92	0.31
93	0.34
94	0.42
95	0.42
96	0.41
97	0.38
98	0.35
99	0.41
100	0.42
101	0.45
102	0.43
103	0.43
104	0.44
105	0.43
106	0.43
107	0.34
108	0.26
109	0.2
110	0.14
111	0.14
112	0.12
113	0.12
114	0.11
115	0.1
116	0.12
117	0.12
118	0.15
119	0.16
120	0.18
121	0.21
122	0.25
123	0.34
124	0.38
125	0.41
126	0.47
127	0.52
128	0.55
129	0.56
130	0.53
131	0.55
132	0.51
133	0.55
134	0.51
135	0.48
136	0.45
137	0.45
138	0.43
139	0.34
140	0.38
141	0.31
142	0.27
143	0.28
144	0.27
145	0.33
146	0.41
147	0.48
148	0.48
149	0.53
150	0.59
151	0.61
152	0.61
153	0.53
154	0.46
155	0.45
156	0.43
157	0.36
158	0.3
159	0.27
160	0.26
161	0.29
162	0.29
163	0.26
164	0.24
165	0.24
166	0.26
167	0.23
168	0.25
169	0.22
170	0.21
171	0.17
172	0.17
173	0.15
174	0.12
175	0.12
176	0.08
177	0.07
178	0.07
179	0.08
180	0.08
181	0.09
182	0.09
183	0.1
184	0.14
185	0.15
186	0.15
187	0.17
188	0.17
189	0.19
190	0.2
191	0.21
192	0.17
193	0.17
194	0.17
195	0.15
196	0.18
197	0.17
198	0.23
199	0.26
200	0.32
201	0.33
202	0.41
203	0.46
204	0.45
205	0.47
206	0.43
207	0.43
208	0.4
209	0.39
210	0.33
211	0.33
212	0.3
213	0.3
214	0.29
215	0.24
216	0.2
217	0.19
218	0.17
219	0.13
220	0.12
221	0.11
222	0.1
223	0.1
224	0.1
225	0.1
226	0.1
227	0.09
228	0.1
229	0.1
230	0.11
231	0.12
232	0.13
233	0.13
234	0.12
235	0.11
236	0.1
237	0.08
238	0.06
239	0.06
240	0.07
241	0.1
242	0.11
243	0.11
244	0.11
245	0.11
246	0.13
247	0.13
248	0.12
249	0.09
250	0.09
251	0.1
252	0.1
253	0.1
254	0.1
255	0.08
256	0.09
257	0.13
258	0.16
259	0.17
260	0.17
261	0.18
262	0.18
263	0.19
264	0.2
265	0.17
266	0.15
267	0.16
268	0.16
269	0.16
270	0.16
271	0.15
272	0.13
273	0.11
274	0.1
275	0.08
276	0.09
277	0.1
278	0.09
279	0.1
280	0.1
281	0.11
282	0.12
283	0.12
284	0.17
285	0.15
286	0.18
287	0.23
288	0.23
289	0.23
290	0.26
291	0.27
292	0.24
293	0.24
294	0.21
295	0.15
296	0.15
297	0.15
298	0.1
299	0.09
300	0.05
301	0.05
302	0.05
303	0.06
304	0.06
305	0.06
306	0.06
307	0.06
308	0.05
309	0.05
310	0.05
311	0.04
312	0.04
313	0.04
314	0.04
315	0.07
316	0.07
317	0.09
318	0.11
319	0.11
320	0.11
321	0.14
322	0.19
323	0.18
324	0.19
325	0.17
326	0.22
327	0.22
328	0.22
329	0.21
330	0.15
331	0.14
332	0.14
333	0.17
334	0.12
335	0.11
336	0.12
337	0.11
338	0.14
339	0.13
340	0.13
341	0.16
342	0.19
343	0.25
344	0.28
345	0.29
346	0.3
347	0.4
348	0.48
349	0.5
350	0.49
351	0.49
352	0.49
353	0.49
354	0.47
355	0.42
356	0.39
357	0.34
358	0.33
359	0.29
360	0.32
361	0.32
362	0.33
363	0.29
364	0.27
365	0.24
366	0.23
367	0.22
368	0.16
369	0.16
370	0.13
371	0.13
372	0.1
373	0.14
374	0.13
375	0.15
376	0.15
377	0.14
378	0.16
379	0.15
380	0.15
381	0.14
382	0.15
383	0.15
384	0.19
385	0.22
386	0.21
387	0.21
388	0.2
389	0.17
390	0.16
391	0.16
392	0.11
393	0.1
394	0.11
395	0.11
396	0.17
397	0.23
398	0.26
399	0.28
400	0.31
401	0.36
402	0.38
403	0.43
404	0.46
405	0.48
406	0.55
407	0.53
408	0.51
409	0.48
410	0.46
411	0.49
412	0.46
413	0.44
414	0.35
415	0.35
416	0.34
417	0.31
418	0.3
419	0.22
420	0.16
421	0.12
422	0.11
423	0.13
424	0.19
425	0.2
426	0.2
427	0.21
428	0.22
429	0.22
430	0.21
431	0.18
432	0.15
433	0.14
434	0.13
435	0.16
436	0.16
437	0.17
438	0.18
439	0.18
440	0.18
441	0.17
442	0.18
443	0.16
444	0.18
445	0.19
446	0.19
447	0.24
448	0.28
449	0.31
450	0.3
451	0.39
452	0.41
453	0.4
454	0.39
455	0.34
456	0.32
457	0.33
458	0.37
459	0.34
460	0.33
461	0.33
462	0.37
463	0.37
464	0.35
465	0.34
466	0.28
467	0.22
468	0.19
469	0.19
470	0.18
471	0.17
472	0.16
473	0.13
474	0.12
475	0.11
476	0.1
477	0.1
478	0.07
479	0.07
480	0.06
481	0.05
482	0.05
483	0.04
484	0.04
485	0.04
486	0.04
487	0.04
488	0.04
489	0.05
490	0.07
491	0.07
492	0.08
493	0.08
494	0.08
495	0.09
496	0.12
497	0.13
498	0.12
499	0.14
500	0.14
501	0.17
502	0.22
503	0.21
504	0.22
505	0.25
506	0.25
507	0.23
508	0.23
509	0.22
510	0.17
511	0.17
512	0.15
513	0.14
514	0.13
515	0.15
516	0.16
517	0.15
518	0.15
519	0.16
520	0.17
521	0.15
522	0.16
523	0.14
524	0.11
525	0.12
526	0.12
527	0.12
528	0.11
529	0.11
530	0.13
531	0.14
532	0.14
533	0.13
534	0.14
535	0.14
536	0.15
537	0.16
538	0.15
539	0.14
540	0.14
541	0.14
542	0.12
543	0.11
544	0.09
545	0.07
546	0.06
547	0.08
548	0.08
549	0.09
550	0.08
551	0.08
552	0.08
553	0.08
554	0.08
555	0.06
556	0.06
557	0.05
558	0.05
559	0.06
560	0.06
561	0.06
562	0.06
563	0.05
564	0.05
565	0.06
566	0.06
567	0.07
568	0.09
569	0.1
570	0.1
571	0.1
572	0.11
573	0.1
574	0.1
575	0.09
576	0.08
577	0.07
578	0.06
579	0.08
580	0.11
581	0.13
582	0.13
583	0.15
584	0.16
585	0.17
586	0.2
587	0.22
588	0.23
589	0.25
590	0.24
591	0.25
592	0.28
593	0.28
594	0.26
595	0.26
596	0.23
597	0.2
598	0.21
599	0.26
600	0.22
601	0.25
602	0.34
603	0.35
604	0.41
605	0.43
606	0.43
607	0.39
608	0.38
609	0.46
610	0.43
611	0.41
612	0.43
613	0.41
614	0.42
615	0.41
616	0.41
617	0.32
618	0.27
619	0.24
620	0.2
621	0.2
622	0.18
623	0.16
624	0.15
625	0.15
626	0.14
627	0.11
628	0.08
629	0.06
630	0.07
631	0.09
632	0.1
633	0.11
634	0.11
635	0.11
636	0.11
637	0.11
638	0.11
639	0.1
640	0.09
641	0.07
642	0.08
643	0.11
644	0.11
645	0.11
646	0.12
647	0.13
648	0.14
649	0.15
650	0.18
651	0.24
652	0.26
653	0.27
654	0.28
655	0.35
656	0.41
657	0.43
658	0.42
659	0.38
660	0.43
661	0.47
662	0.48
663	0.4
664	0.35
665	0.32
666	0.3
667	0.28
668	0.24
669	0.21
670	0.19
671	0.18
672	0.17
673	0.18
674	0.2
675	0.18
676	0.21
677	0.25
678	0.28
679	0.35
680	0.44
681	0.52
682	0.6
683	0.69
684	0.74
685	0.78
686	0.86
687	0.9
688	0.91
689	0.9
690	0.88
691	0.86
692	0.82
693	0.78
694	0.7
695	0.61
696	0.52
697	0.44
698	0.36
699	0.28
700	0.21
701	0.15
702	0.16
703	0.15
704	0.12
705	0.11
706	0.12
707	0.21
708	0.24
709	0.25
710	0.29
711	0.4
712	0.51
713	0.61
714	0.7
715	0.72
716	0.8
717	0.88
718	0.93
719	0.93
720	0.93
721	0.94
722	0.94
723	0.92
724	0.88
725	0.83
726	0.75
727	0.66
728	0.57
729	0.5
730	0.49
731	0.48
732	0.49
733	0.54
734	0.58
735	0.65
736	0.69
737	0.74
738	0.73
739	0.76
740	0.79
741	0.75
742	0.78
743	0.74
744	0.74
745	0.71
746	0.64
747	0.59
748	0.54
749	0.55
750	0.53
751	0.58

G8B8I3

3D AlphaFold-predicted Structure Viewer