Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8BJD8

Protein Details
Accession G8BJD8    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
67-98KAFYKGKKYQPKDLRAKKTRAIRRQLTKFEKSHydrophilic
NLS Segment(s)
PositionSequence
71-108KGKKYQPKDLRAKKTRAIRRQLTKFEKSQETEKAKKQR
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MVAVKTFELRTKSKEQLEEQLIELKKELANLKVQKLQRPSLPRIHIVRKNIARVLTVINLNQRENVKAFYKGKKYQPKDLRAKKTRAIRRQLTKFEKSQETEKAKKQRITFPQRKYAIKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.51
3 0.54
4 0.56
5 0.51
6 0.45
7 0.45
8 0.4
9 0.34
10 0.31
11 0.23
12 0.19
13 0.21
14 0.22
15 0.16
16 0.24
17 0.27
18 0.31
19 0.36
20 0.38
21 0.4
22 0.43
23 0.45
24 0.43
25 0.46
26 0.47
27 0.48
28 0.49
29 0.49
30 0.49
31 0.55
32 0.53
33 0.5
34 0.54
35 0.49
36 0.49
37 0.45
38 0.4
39 0.32
40 0.28
41 0.26
42 0.2
43 0.17
44 0.14
45 0.16
46 0.17
47 0.16
48 0.18
49 0.16
50 0.16
51 0.16
52 0.17
53 0.15
54 0.2
55 0.24
56 0.28
57 0.35
58 0.4
59 0.49
60 0.56
61 0.59
62 0.64
63 0.69
64 0.72
65 0.75
66 0.79
67 0.81
68 0.79
69 0.8
70 0.76
71 0.77
72 0.77
73 0.75
74 0.75
75 0.73
76 0.75
77 0.79
78 0.82
79 0.81
80 0.77
81 0.72
82 0.69
83 0.67
84 0.61
85 0.58
86 0.57
87 0.57
88 0.59
89 0.63
90 0.66
91 0.68
92 0.7
93 0.7
94 0.7
95 0.72
96 0.77
97 0.77
98 0.75
99 0.77
100 0.78