Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3B6H5

Protein Details
Accession G3B6H5    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
12-34LPPLPKLRVRKPFLNKSNNQCLVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20.5, mito_nucl 14, nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017264  Ribosomal_MRP10_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG cten:CANTEDRAFT_114782  -  
Amino Acid Sequences MAYKKLQNSAALPPLPKLRVRKPFLNKSNNQCLVMMSTLLNCWAANGEGSSPCLEAETDLKKCMETFKPEKKQLSSINYHASRLYPKLRGNTND
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.37
3 0.39
4 0.4
5 0.42
6 0.49
7 0.55
8 0.61
9 0.65
10 0.73
11 0.78
12 0.8
13 0.78
14 0.76
15 0.81
16 0.74
17 0.66
18 0.55
19 0.46
20 0.38
21 0.31
22 0.23
23 0.13
24 0.1
25 0.08
26 0.08
27 0.08
28 0.06
29 0.05
30 0.05
31 0.05
32 0.05
33 0.05
34 0.05
35 0.05
36 0.06
37 0.07
38 0.06
39 0.06
40 0.06
41 0.06
42 0.06
43 0.09
44 0.14
45 0.14
46 0.15
47 0.16
48 0.16
49 0.16
50 0.21
51 0.21
52 0.25
53 0.33
54 0.43
55 0.52
56 0.59
57 0.64
58 0.62
59 0.65
60 0.64
61 0.62
62 0.58
63 0.53
64 0.56
65 0.52
66 0.5
67 0.44
68 0.39
69 0.36
70 0.36
71 0.37
72 0.34
73 0.39
74 0.45