Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3B4R4

Protein Details
Accession G3B4R4    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
69-93KSNKIIYKKRMKKTKDKQDEPWFYDHydrophilic
NLS Segment(s)
PositionSequence
77-81KRMKK
Subcellular Location(s) cyto 10.5cyto_nucl 10.5, nucl 9.5, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011893  Selenoprotein_Rdx-typ  
IPR036249  Thioredoxin-like_sf  
KEGG cten:CANTEDRAFT_93360  -  
Pfam View protein in Pfam  
PF10262  Rdx  
Amino Acid Sequences MTSTAYISDIDLGHVKVSIEYCNKCKWQNRAVWYMQELLMTFDGKINEISLLPNNDKPGTFSVSLKTDKSNKIIYKKRMKKTKDKQDEPWFYDGFPDSKFLKVLIRNELFPGDDLGHLDRYQNFTLNDGATGKVEAAPIEPVECKDCQVEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.12
4 0.13
5 0.17
6 0.21
7 0.25
8 0.28
9 0.34
10 0.38
11 0.43
12 0.5
13 0.52
14 0.54
15 0.58
16 0.61
17 0.62
18 0.61
19 0.58
20 0.52
21 0.46
22 0.38
23 0.31
24 0.25
25 0.19
26 0.17
27 0.13
28 0.12
29 0.11
30 0.11
31 0.11
32 0.11
33 0.09
34 0.09
35 0.09
36 0.1
37 0.1
38 0.14
39 0.15
40 0.16
41 0.18
42 0.18
43 0.18
44 0.19
45 0.18
46 0.19
47 0.18
48 0.17
49 0.18
50 0.21
51 0.23
52 0.22
53 0.23
54 0.24
55 0.25
56 0.28
57 0.32
58 0.32
59 0.39
60 0.46
61 0.52
62 0.58
63 0.65
64 0.7
65 0.72
66 0.74
67 0.76
68 0.79
69 0.81
70 0.81
71 0.78
72 0.79
73 0.8
74 0.82
75 0.74
76 0.68
77 0.57
78 0.45
79 0.41
80 0.33
81 0.24
82 0.17
83 0.17
84 0.13
85 0.14
86 0.14
87 0.13
88 0.17
89 0.21
90 0.24
91 0.29
92 0.29
93 0.29
94 0.3
95 0.3
96 0.26
97 0.21
98 0.2
99 0.12
100 0.11
101 0.12
102 0.12
103 0.13
104 0.13
105 0.15
106 0.15
107 0.19
108 0.2
109 0.22
110 0.21
111 0.21
112 0.23
113 0.21
114 0.21
115 0.17
116 0.17
117 0.13
118 0.13
119 0.12
120 0.11
121 0.11
122 0.1
123 0.1
124 0.11
125 0.11
126 0.12
127 0.13
128 0.14
129 0.16
130 0.17
131 0.17