Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8BCD3

Protein Details
Accession G8BCD3    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MPRSSKSAKLKIKKTSPPPQGYDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 8.5, cyto_nucl 6, pero 3, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001748  BUD31  
Gene Ontology GO:0071014  C:post-mRNA release spliceosomal complex  
GO:0000974  C:Prp19 complex  
GO:0005686  C:U2 snRNP  
GO:0005684  C:U2-type spliceosomal complex  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF01125  G10  
Amino Acid Sequences MPRSSKSAKLKIKKTSPPPQGYDKIAPTILKYKQKLKTATTNNTTNTNASSSSTTDTFPPGTKPTSLWPIYKITHDVTRYVYDLYQRDKISNELYTWLTLQDYVDALLIAKWKKQGYEKLCCTQCIGGGAGGGTCICRVPKVELLKRGQDDKVDVECVTCGCRGCASSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.84
3 0.84
4 0.82
5 0.78
6 0.77
7 0.73
8 0.69
9 0.65
10 0.57
11 0.5
12 0.44
13 0.4
14 0.34
15 0.36
16 0.37
17 0.4
18 0.41
19 0.47
20 0.52
21 0.59
22 0.61
23 0.6
24 0.63
25 0.63
26 0.68
27 0.65
28 0.63
29 0.57
30 0.56
31 0.52
32 0.42
33 0.34
34 0.27
35 0.21
36 0.18
37 0.17
38 0.14
39 0.16
40 0.15
41 0.15
42 0.14
43 0.15
44 0.15
45 0.14
46 0.15
47 0.15
48 0.16
49 0.16
50 0.17
51 0.18
52 0.24
53 0.26
54 0.24
55 0.24
56 0.27
57 0.27
58 0.27
59 0.26
60 0.21
61 0.23
62 0.23
63 0.22
64 0.2
65 0.2
66 0.19
67 0.18
68 0.16
69 0.15
70 0.17
71 0.18
72 0.21
73 0.2
74 0.2
75 0.2
76 0.22
77 0.2
78 0.19
79 0.17
80 0.14
81 0.14
82 0.14
83 0.13
84 0.12
85 0.09
86 0.08
87 0.08
88 0.06
89 0.06
90 0.05
91 0.05
92 0.05
93 0.05
94 0.05
95 0.09
96 0.09
97 0.1
98 0.14
99 0.14
100 0.17
101 0.23
102 0.31
103 0.35
104 0.45
105 0.49
106 0.54
107 0.55
108 0.53
109 0.5
110 0.42
111 0.36
112 0.28
113 0.23
114 0.14
115 0.12
116 0.12
117 0.09
118 0.08
119 0.07
120 0.05
121 0.04
122 0.05
123 0.06
124 0.07
125 0.09
126 0.14
127 0.21
128 0.31
129 0.38
130 0.45
131 0.5
132 0.57
133 0.59
134 0.58
135 0.53
136 0.46
137 0.43
138 0.39
139 0.37
140 0.32
141 0.28
142 0.24
143 0.23
144 0.21
145 0.2
146 0.17
147 0.14
148 0.13
149 0.16