Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8B5P7

Protein Details
Accession G8B5P7   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
65-85TFIGKVLIKNQQKQKSKKKAQHydrophilic
NLS Segment(s)
PositionSequence
80-83SKKK
Subcellular Location(s) plas 10, E.R. 7, mito 4, vacu 3, extr 2, cyto_mito 2, mito_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009914  DPM2  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0030234  F:enzyme regulator activity  
GO:0019348  P:dolichol metabolic process  
GO:0006486  P:protein glycosylation  
Pfam View protein in Pfam  
PF07297  DPM2  
Amino Acid Sequences MAADKLLGFAMLFVAASVFTYYTAWVFVIPFVNEDSCINKFFLPRDYAIKLPLLLLLIAGLGVGTFIGKVLIKNQQKQKSKKKAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.05
5 0.05
6 0.05
7 0.05
8 0.06
9 0.06
10 0.07
11 0.06
12 0.06
13 0.06
14 0.07
15 0.09
16 0.08
17 0.09
18 0.09
19 0.09
20 0.1
21 0.1
22 0.12
23 0.11
24 0.12
25 0.12
26 0.12
27 0.13
28 0.14
29 0.17
30 0.16
31 0.16
32 0.19
33 0.2
34 0.2
35 0.2
36 0.19
37 0.16
38 0.14
39 0.13
40 0.09
41 0.07
42 0.06
43 0.05
44 0.04
45 0.04
46 0.03
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.02
54 0.04
55 0.04
56 0.05
57 0.09
58 0.19
59 0.26
60 0.34
61 0.44
62 0.53
63 0.63
64 0.73
65 0.81